KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3616Help
Entry
AHA_3616          CDS       T00424                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AHA_3616 (glgB)
Enzymes [BR:aha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AHA_3616 (glgB)
Exosome [BR:aha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AHA_3616 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4058299..4060476)
Genome map
AA seq 725 aa AA seqDB search
MLVERLVAARCSDPFSHLGLQANPDGPGLKLTVWLPDAQAVRVRDLKSGKIVATLAPTDD
SGLFETVFTRRKNPFPYQLLADYPDASVEVIDPYQFQDAGWAGLAELTYQPENLYHTLGA
QLRTVAHLDQQVEGVRFAVYAPSATAVSLIGDFNFWDGRRHPMQRSQCGHWVLFVPGLKA
GDRYKFELKDPAGNRLPHKSDPVGFYCEQYPSFASVVYDHDQYQWQDAAWRESQLNDKRE
QPLSIYELHVGSWKRHPNGDSLSWRELAVELVDYVKGMEYTHIELLPVSEHPFSGSWGYQ
PVGMFSPTSRYGTADDFKYFVDQCHQAGIGVILDWVPAHFPSDAHGLARFDGTPLYEYED
PRRGWHPDWNSYIYDFGRNTVRQFLVASALFWLDKFHVDGLRVDAVASMLYLDYSRNAGE
WVPNVDGGNHNYEAISLLKWTNEEVYGKYPHAMTIAEESTAFAGVSRPTFLGGLGFGFKW
NMGWMHDTLTYMQKEPIHRRYHHNDMTFSMVYHYDENFILSLSHDEVVHGKHSMLYKMPG
DEWQQAANLRAYMGFMYAHPGKKLNFMGTEIAQSNEWNHDAQLPWHLLQYPKHGGQQRLI
HDLNHLYRHEPALYQADYEQNGFRWLDHNDADNSIFAWLRADKQGANPLVVACNFTPVPR
LAYRLGVPAAGHYRVVLNTDSEHYWGSNYDVGLVFVAEPTPWQGMMHSIVLDLPPLATLF
IKQES
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttgaacgtttggttgcagcccgctgttccgatcccttctcccacttaggcctg
caggccaatccggatgggcccggcctcaagctgaccgtctggttacccgatgcccaggcc
gtacgggtcagggatctcaagtcgggcaagattgttgccaccctggcgcccaccgatgat
tcgggcctctttgaaactgttttcacccgccgtaaaaatcccttcccctaccagttgctt
gccgactacccagatgccagcgtcgaggtcatcgatccctaccagttccaggatgcgggc
tgggccgggttggcggaactcacctaccagccggaaaacctctaccacacgctcggtgcc
cagctgcgcaccgtggcgcatctggaccagcaagtggagggggtgcgttttgcagtctat
gcgccgagcgccactgcggtgagcctgatcggcgatttcaacttctgggatggccgccgt
cacccgatgcagcgcagccagtgcggtcactgggtgctgttcgtgccgggcctcaaggcc
ggggatcgctataaattcgaactgaaagacccggcgggcaaccggctgccgcacaagagc
gacccagtcggtttctactgcgagcagtacccctcgttcgcctccgtggtctatgaccac
gaccagtaccagtggcaggatgccgcctggcgcgagagccagctcaacgacaagcgcgag
cagccgctttccatctacgagctgcacgtgggctcctggaagcgtcaccccaacggcgac
agcctgagctggcgcgaactggcggtggaactggtggattacgtcaaggggatggaatac
acccacatcgagttgctgccggtctccgagcacccgttcagtggctcctggggctaccag
ccggtgggcatgttctcgcccaccagccgttacggcacggctgatgatttcaaatacttc
gtggatcagtgccaccaggccggtattggcgtcatcctcgactgggtgcctgcccacttc
ccgtccgatgcccacgggctggcccgcttcgacggcaccccgctctacgagtacgaggat
ccgcgccgtggctggcacccggactggaactcctacatctatgacttcggtcgcaatacg
gtgcgccagttcctggtggccagcgccctgttctggctcgacaagttccacgtcgacggc
ctgcgggtggatgcggtcgcctccatgctctatctggactattcgcgcaacgccggcgag
tgggtgcccaacgtcgatggcggcaaccacaactacgaggcgatcagcctgctcaagtgg
accaacgaagaggtgtacggcaagtacccccacgccatgaccatcgccgaggagtccacc
gcctttgccggggtctcccgtcccaccttcctggggggcctgggctttggcttcaagtgg
aatatgggctggatgcacgacaccctcacctacatgcagaaagagcccattcaccgtcgc
taccaccacaacgacatgaccttctccatggtgtaccactatgacgagaacttcattttg
tcgctctcccacgacgaggtggtgcacggcaagcactccatgctctacaagatgccgggt
gacgagtggcagcaggcggccaacctgcgcgcctacatgggcttcatgtatgcccatccc
ggcaagaagctcaacttcatgggcaccgagatcgcccagagcaacgagtggaatcacgat
gcccagctgccctggcacctgctgcagtatcccaagcacggtggccagcagcggctgatc
cacgatctcaaccacctctaccgtcatgaacctgccttgtatcaggcggattatgagcaa
aacggcttccgctggctggatcacaacgacgctgacaacagcatctttgcctggctgcgg
gccgacaagcagggggccaacccgctggtggtagcctgcaacttcacgccggtgccgcgg
cttgcctatcggctcggggtgccggcggccggtcactaccgggtggtgctcaacaccgac
agcgagcattactggggcagcaactatgatgtgggtctggtcttcgtcgccgagccgacc
ccctggcaggggatgatgcacagcatagtgctggatctgccgccgctcgcgaccttgttc
atcaaacaggagtcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system