KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3616Help
Entry
AHA_3616          CDS       T00424                                 

Gene name
glgB
Definition
(RefSeq) glycogen branching protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00500  Starch and sucrose metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AHA_3616 (glgB)
Enzymes [BR:aha01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AHA_3616 (glgB)
Exosome [BR:aha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AHA_3616 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 4487854
NCBI-ProteinID: YP_858086
UniProt: A0KP85
Position
complement(4058299..4060476)
Genome map
AA seq 725 aa AA seqDB search
MLVERLVAARCSDPFSHLGLQANPDGPGLKLTVWLPDAQAVRVRDLKSGKIVATLAPTDD
SGLFETVFTRRKNPFPYQLLADYPDASVEVIDPYQFQDAGWAGLAELTYQPENLYHTLGA
QLRTVAHLDQQVEGVRFAVYAPSATAVSLIGDFNFWDGRRHPMQRSQCGHWVLFVPGLKA
GDRYKFELKDPAGNRLPHKSDPVGFYCEQYPSFASVVYDHDQYQWQDAAWRESQLNDKRE
QPLSIYELHVGSWKRHPNGDSLSWRELAVELVDYVKGMEYTHIELLPVSEHPFSGSWGYQ
PVGMFSPTSRYGTADDFKYFVDQCHQAGIGVILDWVPAHFPSDAHGLARFDGTPLYEYED
PRRGWHPDWNSYIYDFGRNTVRQFLVASALFWLDKFHVDGLRVDAVASMLYLDYSRNAGE
WVPNVDGGNHNYEAISLLKWTNEEVYGKYPHAMTIAEESTAFAGVSRPTFLGGLGFGFKW
NMGWMHDTLTYMQKEPIHRRYHHNDMTFSMVYHYDENFILSLSHDEVVHGKHSMLYKMPG
DEWQQAANLRAYMGFMYAHPGKKLNFMGTEIAQSNEWNHDAQLPWHLLQYPKHGGQQRLI
HDLNHLYRHEPALYQADYEQNGFRWLDHNDADNSIFAWLRADKQGANPLVVACNFTPVPR
LAYRLGVPAAGHYRVVLNTDSEHYWGSNYDVGLVFVAEPTPWQGMMHSIVLDLPPLATLF
IKQES
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgctcgttgaacgtttggttgcagcccgctgttccgatcccttctcccacttaggcctg
caggccaatccggatgggcccggcctcaagctgaccgtctggttacccgatgcccaggcc
gtacgggtcagggatctcaagtcgggcaagattgttgccaccctggcgcccaccgatgat
tcgggcctctttgaaactgttttcacccgccgtaaaaatcccttcccctaccagttgctt
gccgactacccagatgccagcgtcgaggtcatcgatccctaccagttccaggatgcgggc
tgggccgggttggcggaactcacctaccagccggaaaacctctaccacacgctcggtgcc
cagctgcgcaccgtggcgcatctggaccagcaagtggagggggtgcgttttgcagtctat
gcgccgagcgccactgcggtgagcctgatcggcgatttcaacttctgggatggccgccgt
cacccgatgcagcgcagccagtgcggtcactgggtgctgttcgtgccgggcctcaaggcc
ggggatcgctataaattcgaactgaaagacccggcgggcaaccggctgccgcacaagagc
gacccagtcggtttctactgcgagcagtacccctcgttcgcctccgtggtctatgaccac
gaccagtaccagtggcaggatgccgcctggcgcgagagccagctcaacgacaagcgcgag
cagccgctttccatctacgagctgcacgtgggctcctggaagcgtcaccccaacggcgac
agcctgagctggcgcgaactggcggtggaactggtggattacgtcaaggggatggaatac
acccacatcgagttgctgccggtctccgagcacccgttcagtggctcctggggctaccag
ccggtgggcatgttctcgcccaccagccgttacggcacggctgatgatttcaaatacttc
gtggatcagtgccaccaggccggtattggcgtcatcctcgactgggtgcctgcccacttc
ccgtccgatgcccacgggctggcccgcttcgacggcaccccgctctacgagtacgaggat
ccgcgccgtggctggcacccggactggaactcctacatctatgacttcggtcgcaatacg
gtgcgccagttcctggtggccagcgccctgttctggctcgacaagttccacgtcgacggc
ctgcgggtggatgcggtcgcctccatgctctatctggactattcgcgcaacgccggcgag
tgggtgcccaacgtcgatggcggcaaccacaactacgaggcgatcagcctgctcaagtgg
accaacgaagaggtgtacggcaagtacccccacgccatgaccatcgccgaggagtccacc
gcctttgccggggtctcccgtcccaccttcctggggggcctgggctttggcttcaagtgg
aatatgggctggatgcacgacaccctcacctacatgcagaaagagcccattcaccgtcgc
taccaccacaacgacatgaccttctccatggtgtaccactatgacgagaacttcattttg
tcgctctcccacgacgaggtggtgcacggcaagcactccatgctctacaagatgccgggt
gacgagtggcagcaggcggccaacctgcgcgcctacatgggcttcatgtatgcccatccc
ggcaagaagctcaacttcatgggcaccgagatcgcccagagcaacgagtggaatcacgat
gcccagctgccctggcacctgctgcagtatcccaagcacggtggccagcagcggctgatc
cacgatctcaaccacctctaccgtcatgaacctgccttgtatcaggcggattatgagcaa
aacggcttccgctggctggatcacaacgacgctgacaacagcatctttgcctggctgcgg
gccgacaagcagggggccaacccgctggtggtagcctgcaacttcacgccggtgccgcgg
cttgcctatcggctcggggtgccggcggccggtcactaccgggtggtgctcaacaccgac
agcgagcattactggggcagcaactatgatgtgggtctggtcttcgtcgccgagccgacc
ccctggcaggggatgatgcacagcatagtgctggatctgccgccgctcgcgaccttgttc
atcaaacaggagtcttga

DBGET integrated database retrieval system