KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3617Help
Entry
AHA_3617          CDS       T00424                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aha00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4060559..4062835)
Genome map
AA seq 758 aa AA seqDB search
MAHRATVQVPPIKINQNSIDRIHSGNSQTMTTLIEQLAAAKGIASEYVDAWGHPAQVSEE
SKAAMLGAMGYRVDDEAALTEQLEQEHRQHWLRALDPVMVVRSGEPITLEVRLPIEFVND
ALSWQLKLEQGGLLSGQLTPIDGELVGVAEFEEMECQAYRVALAVQPELGYHDLILLEEG
NDEPLASMRLIVAPKACYKQPPIANGRKVWGPSVQLYCLRSRHNWGIGDFSDLGQLVEKM
AAWGAHFVGLNPIHALYPANPESASPYSPSSRRWLNVAYIDVEAVPEFLANARLKAEVAN
PAFQQHLSELRAKGNVDYTGVVETKLGMLRQVFDQASLSAERQAAFDAFVAAGGDSLQQQ
AAFDALQAHFYAKGENAWGWPVWPEPFRDYHNPEVAAWMAEHRQDVNFYLYLQFLADEQL
ARADARAKAAGMVMGIYRDLAVGVSEGSTEIWANRDLYCPKASVGAPPDILGPLGQNWGL
PPMNPNQLFEAAYQPMVDLFRANMRSCGALRIDHVMALLRLWWVPPGESAAKGAYIYYPV
NDLLGILALESHRNQCLLIGEDLGTVPEGIDVTLKENGVHSYKVFFFERSKADGGFISPA
HYAEQAMSALTTHDMPTLKGFWHCDDLALGRELGLYPDEDVLKTLYADRHQAKQRILDSL
HGHGVISGNISHDVNWVGMNTELNHGLQLHMSRGSCALFSTQLEDWLEMDKPVNVPGTSY
EYPNWRRKLSTDLEDIFANEALKALAGKMSQARDEASR
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atggcccatagagccactgttcaagtaccacccataaaaattaatcaaaatagtatagat
agaatccacagcgggaattctcaaactatgaccaccctgattgaacagctggctgccgcc
aaaggtatcgccagcgagtatgttgatgcctggggccacccggctcaggtatccgaagag
agcaaggccgccatgctgggcgccatgggttaccgcgtcgatgacgaggccgccctgacc
gagcagcttgagcaggagcaccgccagcactggctgcgtgcgctggatcccgtgatggtg
gtccgcagcggcgagcccattaccctcgaagttcgtctgcccatcgaattcgtcaacgac
gccctcagctggcagctcaagctggagcagggcggcctgttgtccggtcagctcaccccc
atcgacggcgagctggtcggcgtggccgaattcgaagagatggagtgccaggcctatcgc
gtggccctggctgtgcagcccgagctgggttatcacgatctgatcctgctggaggagggc
aacgacgagccgctcgccagcatgcgcctcatcgttgcgcccaaggcgtgctacaagcag
cctcccatcgccaatggccgcaaggtgtggggcccgagtgtgcagctctactgcctgcgc
agccgccacaactggggcatcggcgatttcagcgatctgggccaactggtcgagaagatg
gccgcctggggcgctcacttcgtcggtctcaacccgattcatgccctctatccggccaac
ccggagagcgccagcccctacagcccctcgtcccgccgctggctcaacgtggcctacatc
gatgtggaagcggtgcccgaatttctggccaatgcccggctcaaggccgaggtggcgaac
cccgccttccagcagcacttgagcgagctgcgcgccaagggcaacgtggattacaccggc
gttgtcgagaccaaactcggcatgctgcgtcaggtgttcgaccaggccagcctgagcgcc
gagcgtcaggctgccttcgatgccttcgttgccgccggcggcgacagcctgcagcaacag
gccgccttcgatgccctgcaagcccacttctacgccaaaggcgagaatgcctggggctgg
ccggtgtggccggagccgttccgtgattaccacaatcccgaagtggcggcctggatggcc
gagcaccgccaggatgtgaatttctacctctatctgcagttcctggccgacgagcagctg
gcccgggccgacgcccgtgccaaggcggccggcatggtgatggggatctaccgcgatctg
gcggtgggcgtctccgaaggctccaccgagatctgggccaaccgggatctctactgcccg
aaagcctcggtcggtgcgccgcccgatattctgggtccgctcggccagaactggggcctg
ccccccatgaacccgaaccagctgttcgaggcggcctaccagccgatggtggatctgttc
cgtgccaacatgcgctcctgcggcgcgctgcgcatcgaccacgtgatggccttgctgcgc
ctgtggtgggtgccgcccggagagtcggccgccaagggcgcctacatctattacccggtc
aacgacctgctcggcatcctggccctcgagtcccaccgcaaccagtgtctgctgatcggc
gaggatctgggtaccgtgccggaggggatcgacgtgaccctgaaagagaacggcgtccac
tcctacaaggtgttcttcttcgagcgctccaaggccgatggcggcttcatctctccggct
cactacgccgagcaggcgatgtcggcgttgaccacccacgacatgccgaccctcaagggc
ttctggcattgtgacgatctggcgttgggacgtgagctgggcttgtatccggatgaagac
gtactcaagaccctgtatgctgatcgccaccaggccaagcagcggatcctcgacagcctg
cacggccacggggtgatctccggtaacatcagccacgacgtgaactgggtcggcatgaac
accgagctcaaccacggtctgcaactgcacatgtctcgcggcagctgcgccctgttcagt
acccagctggaggattggctggagatggacaagccggtcaacgtgccgggcaccagttac
gagtacccgaactggcgccgcaagctgtctaccgatctggaggatatttttgccaatgag
gcgctcaaggcgctggcaggcaagatgagccaggcccgtgacgaggccagtcgttga

DBGET integrated database retrieval system