KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3701Help
Entry
AHA_3701          CDS       T00424                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aha00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aha00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:aha03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:aha03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:aha03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4134736..4135191
Genome map
AA seq 151 aa AA seqDB search
MSQVTFYLMSEQDDAQASAVERLACQLVADSWGAGHLYLLCDDEAQALRLDELLWQLPPE
RFVPHQLQGESGQAPVEIGHQPPRRRYARLINLAKQTPLFAGHFAQVVDFVPTDETQKQQ
ARERYKHYRQAGHALEMRDQPVLAAPDPAQP
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtgaccttttacctgatgagcgagcaggatgacgcgcaggcttcggccgtc
gaacgcctcgcctgccagctcgtagccgatagctggggggcgggtcatctctacctgctg
tgcgacgacgaagcgcaagccctgcgcctcgacgaactgctgtggcagctgccgccggag
cgcttcgtgccgcaccagttgcagggcgagagcggtcaggcaccggtggagatcggtcat
cagccgccacggcggcgctatgcccgcctcatcaatctggccaaacagacacctttgttt
gcaggacacttcgctcaagtggtagattttgtccccactgacgaaacgcaaaagcagcaa
gcccgcgagcgctacaagcactatcgccaggcaggccacgccctcgagatgagggatcag
cccgtccttgccgcaccggatccggcgcagccctga

DBGET integrated database retrieval system