KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3701Help
Entry
AHA_3701          CDS       T00424                                 

Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AHA_3701
   00240 Pyrimidine metabolism
    AHA_3701
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AHA_3701
   03430 Mismatch repair
    AHA_3701
   03440 Homologous recombination
    AHA_3701
Enzymes [BR:aha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AHA_3701
DNA replication proteins [BR:aha03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AHA_3701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4134736..4135191
Genome map
AA seq 151 aa AA seqDB search
MSQVTFYLMSEQDDAQASAVERLACQLVADSWGAGHLYLLCDDEAQALRLDELLWQLPPE
RFVPHQLQGESGQAPVEIGHQPPRRRYARLINLAKQTPLFAGHFAQVVDFVPTDETQKQQ
ARERYKHYRQAGHALEMRDQPVLAAPDPAQP
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagtgaccttttacctgatgagcgagcaggatgacgcgcaggcttcggccgtc
gaacgcctcgcctgccagctcgtagccgatagctggggggcgggtcatctctacctgctg
tgcgacgacgaagcgcaagccctgcgcctcgacgaactgctgtggcagctgccgccggag
cgcttcgtgccgcaccagttgcagggcgagagcggtcaggcaccggtggagatcggtcat
cagccgccacggcggcgctatgcccgcctcatcaatctggccaaacagacacctttgttt
gcaggacacttcgctcaagtggtagattttgtccccactgacgaaacgcaaaagcagcaa
gcccgcgagcgctacaagcactatcgccaggcaggccacgccctcgagatgagggatcag
cccgtccttgccgcaccggatccggcgcagccctga

DBGET integrated database retrieval system