KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3889Help
Entry
AHA_3889          CDS       T00424                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    AHA_3889 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AHA_3889 (murE)
Enzymes [BR:aha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     AHA_3889 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4321246..4322730)
Genome map
AA seq 494 aa AA seqDB search
MLSRALDQLMRPFGITAPALALTDIQLDSRRVGPGCLFVAIRGHQVDGRRFIEQAVAQGA
TAVLFEEDGEFVAPALGVPCLGIPDLPARLSELAGYFYDQPASKLDLVGITGTNGKSTTA
LLVANWCTLLGGKAGVMGTIGNGLFGELVEAENTTGSAVQVQANLAALQAQGADLVAMEV
SSHGLVQHRVAALPFAAAVFTNLSRDHLDYHGTMEAYGAAKEELLKLVAEPCAVLNADDR
LGRQWLAAYPAAVAFSVHGPVAGHPGRQLTAQDPHFHQQGFRTQINSSWGNGVLSAPLLG
RFNVSNVLAAMGAMLVLGYDFDELLASAPQLQPVTGRMECFGGGKAPLAVVDYAHTPDAL
EKALQALRVHCEGRLWCLVGCGGDRDRGKRPMMAAMAELHADRVILTDDNPRTEEPARIM
ADMVAGLRDPGAVQIEHDRTKAIELALSQASKQDIILVAGKGHEDYQIIGTDKRHYSDRE
TVAAALHTLLESFA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcccgcgcacttgatcaactgatgcgcccctttggcattactgccccggcgctc
gcgcttacagacatccagctggacagtcggcgggtcgggcccggttgtctcttcgtagcg
attcgcgggcatcaggtggatggcagacggtttatcgaacaggcggtggctcagggagcg
accgccgtactgtttgaagaggacggtgaattcgtggcaccggcgctgggcgtgccttgt
ctcgggatcccggatctgccagccaggctctccgagctggccggctatttctacgaccag
ccggccagcaagctggatctggtgggcatcaccggcaccaacggcaagagcaccacggcg
ctgctggtggccaactggtgcaccctgctggggggcaaggccggggtgatgggcaccatc
ggcaacggcctgttcggcgagctggtggaagcggaaaacaccaccggcagcgcggtgcag
gtgcaggccaatctggccgctctgcaagcgcagggggcggatctggtggcgatggaggtg
tccagccacggcctggtacagcatcgcgtcgcggccctgccgtttgctgccgccgtattc
accaacctgagccgggatcatctggactatcacggcaccatggaggcctacggcgccgcc
aaggaagagctgctgaaactggtggccgaaccctgcgccgtgctcaatgccgacgaccgg
ttgggccgccagtggctggctgcctatccggctgccgtggcgttcagcgtgcacggcccg
gtggccggtcacccggggcgacagctgacggcgcaggatccccatttccaccagcaaggt
tttcgcacgcagattaactccagctgggggaatggtgtattatccgcccccttgctcggg
cgcttcaacgtcagcaacgtgctggccgcgatgggcgccatgctggtgctcggttatgac
ttcgacgagctgctggccagcgcgccgcaactgcagccggtaaccggccgcatggagtgc
ttcggtggcggcaaggcgccgctcgccgtggtcgattatgcccacacgccggatgcgctg
gagaaggccttgcaggccctgcgggtgcactgtgaaggacggctctggtgtctggtgggt
tgtggtggcgacagggatcgcggcaagcggcccatgatggccgccatggccgagctgcat
gcggatcgcgtgatcctgaccgatgacaatccccgtaccgaggagccggcccggatcatg
gccgacatggtggcgggtcttcgcgatcccggcgccgtgcagatcgagcacgacaggacc
aaggcaatcgagctggcactgagccaggcgagcaaacaggacatcatcctggtggccggt
aagggtcatgaggattatcagatcattggaaccgacaagcggcactacagcgaccgggaa
accgttgcggccgccttgcacacattattggagtcattcgcatga

DBGET integrated database retrieval system