KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_3974Help
Entry
AHA_3974          CDS       T00424                                 

Gene name
recD
Definition
(RefSeq) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:aha00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AHA_3974 (recD)
Enzymes [BR:aha01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AHA_3974 (recD)
DNA repair and recombination proteins [BR:aha03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AHA_3974 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 AAA_22 UvrD-helicase AAA_16 UvrD_C AAA_28 CbiA NTPase_1 T2SSE SRP54 AAA_24 DUF2075
Motif
Other DBs
NCBI-GeneID: 4489799
NCBI-ProteinID: YP_858408
UniProt: A0KQ57
Position
complement(4405048..4407102)
Genome map
AA seq 684 aa AA seqDB search
MNGTMMIERLKALALAGRIRQLDLQFARLVADLGGSPELVLGAALACFELGRGHVCLPLE
MLTHSGNEKGSLRPFGLDPDQSRDLLADLADPARWPALFAESPLVGSEQDEGLAPRWPLR
LWHGRLYLTRYHDFELGVARHLRALSERAEWPEIAPALSRLFARDYGLVFAALLKARLAP
DFSARHFTLKYLDLVFPNEVDWLAIEGLLASAQAASDLSKLDALVPEALCCNGQKLAAAT
AAARPFAVISGGPGTGKTTTVAKLLAILVETGLQAGKAPAIRLVAPTGKAAARLTESIGS
ALQALDLPPEWVEAIPTEAGTLHRLLGVIPGRSQFRHHAGNPLHLDLLVVDEASMVDLPM
MARLLDALPSHARLILLGDKDQLASVEAGAVLGDICSFIEQGISPAQADWLSRQTGYRLQ
GSPAGATVRDSLCLLAKSWRFDQHSGIGQLARACNSGDATAVESVWGAGFADISLHPWAG
EAYDALIAQGVAGYGSYLKAARAGEAPAAVFKAFNSFQILCALRDGPFGVLGLNERLELA
LSRAGLIACDGDWYAGRPVMVVRNDHGVGLYNGDMGLCLPDETGRLKVWFEQPDGTLRAL
LPSRLPPHETVYAMTIHKSQGSEFAHTVLVLPDSPSPLLTRELVYTGITRAKARLDLYGD
RALLAQAVRKKTERYSGLAERLGE
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaccatgatgattgaacggctcaaggccctggcgctggctggccgtatccgc
cagctggatctgcaatttgccaggctggtggccgacctaggcggcagtcccgagctggtg
ctgggggcggcgctcgcctgcttcgaactggggcgcgggcatgtctgtctgccgctggaa
atgttgacgcattccggtaacgaaaagggatccttgcgcccgttcgggctggatccggat
cagagtcgggatctgctggccgatctggcggatcctgcccgctggcccgccctgtttgca
gagagtcccctggttggcagcgagcaggatgaggggctcgccccgcgctggccgctgcgg
ctctggcacgggcggctctacctcacccgctaccacgattttgaactgggggtggcccgc
catctgcgcgctttgagcgagcgagccgaatggccggagattgccccggctctgtcgcgg
ctgtttgcccgcgactacgggttggtgttcgcggcgctgctcaaggcccgcctcgccccc
gacttctcggcccgccactttaccctgaagtatctcgatctggtgttcccgaatgaagtg
gactggctcgctatcgaaggactgctggccagcgcccaggcggcgagcgacttgagcaaa
ctggatgcgctggtgcccgaggcgctctgctgcaacggccagaagctggcggcggccacc
gcggcggcgcgcccctttgcggtgatctccggcggccccggcaccggcaagaccaccacg
gttgccaaactgctcgccattctggtggagaccggcctgcaagcgggcaaggccccggcg
atccggctggtggcccccaccggcaaggcggcggcgcgcctgaccgagagtatcggctct
gccctgcaggccctcgatctgccccccgaatgggtcgaagcgatccccaccgaggcgggc
accttgcaccggctgctcggggtcattccggggcgcagccagttccgccaccacgcgggc
aacccgctgcacctcgacctgctggtggtggatgaggcctccatggtcgacttgccgatg
atggcgcgcctgctcgatgcgctgccgagccacgcccgcctgatcctgcttggcgacaag
gatcagctcgcctcggtggaggcgggggccgtgctcggcgatatctgcagctttatcgaa
cagggcatcagcccggcgcaggcggactggctctcccgccagaccggctaccgcttgcag
ggctcgcccgcaggggcaaccgtgcgcgacagcctctgcctgctggccaagagctggcgc
tttgatcagcactccggcatcggccagctggcgcgcgcctgcaacagcggcgatgccaca
gcggtggaatcagtctggggcgcaggatttgccgatatcagcctgcacccctgggccgga
gaggcctacgatgccttgattgcccagggggtggccggttacggcagctatctgaaggcg
gctcgcgcaggggaagcgcccgccgccgtgttcaaggcattcaacagcttccagatcctc
tgcgccctgcgtgacggcccgttcggggtgctggggctcaacgagcggctcgaactggcc
ctgtcacgggccggcctgattgcctgcgatggcgactggtatgccggtcgcccggtgatg
gtggtgcgcaacgatcacggggtcggcctctacaacggtgatatggggctctgcctgccc
gatgaaaccggccggttaaaggtatggtttgagcagccggacggcaccctgcgggccctg
ctgccaagccgcttgccgccccacgagacggtctacgccatgaccatccacaaatcccag
ggctcggagtttgcccataccgtgctggtgttgcccgacagccccagcccactgctgacc
cgcgagctggtctataccggcatcacccgcgccaaggcgcgcctcgatctctacggcgac
cgagccctgctggcacaagcggtacgaaaaaagaccgagcgttattccggattggcggag
aggttgggggagtga

DBGET integrated database retrieval system