KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_4063Help
Entry
AHA_4063          CDS       T00424                                 

Definition
pteridine reductase 1
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aha00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aha00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4499699..4500403)
Genome map
AA seq 234 aa AA seqDB search
MRALVTGCGRRLGFYLCEQLVAAGWQVTGSYRSERPELARLRALGVELVQADFAREEEVG
KLIEALAVHQDLALVIHNASAFEPQAADPAAQLAQFDQFYRVHMAAPFQLNRALASQLAR
NANAGIIHITDIYIHAPAPQFASYVATKAGAHSLAMSFARELAPAVRVNTIEPGPILFLD
EHGDAWRQQVLAKTPLAREGGLEPIWQAVQLLMQNDYMTGASIRVDGGRGLAVI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattggtgacggggtgtggccgccggcttggtttctatctgtgcgaacagctg
gtggcggcgggttggcaggtgacgggcagctatcgcagcgagcgacccgagctggcgcgg
ctgcgagcgctgggggtcgagctggtgcaggcggatttcgcgcgcgaggaggaggtcggc
aagctgatcgaggcgctggccgtccatcaggatctggcgctggtgatccacaacgcctcg
gcgtttgagccgcaggcggcggatccggcggcgcagctggcccagtttgatcagttctac
cgggtgcacatggcggcccccttccagctaaaccgcgcgctggcgtcccagctggcgcgc
aacgccaatgccggcatcatccatatcaccgacatctacatccacgcgccggcaccccag
tttgccagctatgtggccaccaaggcgggggcccactcgctggccatgagctttgcccgc
gagctggcacccgccgtccgggtcaataccatagagccgggccccatcctgtttctcgac
gaacatggcgatgcgtggcgccagcaggtgctggcgaagacgccgctggcgcgggaaggg
gggctggagcccatctggcaggcagttcagctgttgatgcagaacgactacatgaccggg
gccagcatccgggtggatggtggccgcggtctggccgtcatctag

DBGET integrated database retrieval system