KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_4063Help
Entry
AHA_4063          CDS       T00424                                 

Definition
pteridine reductase 1
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AHA_4063
   00670 One carbon pool by folate
    AHA_4063
Enzymes [BR:aha01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AHA_4063
    1.5.1.-  
     AHA_4063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4499699..4500403)
Genome map
AA seq 234 aa AA seqDB search
MRALVTGCGRRLGFYLCEQLVAAGWQVTGSYRSERPELARLRALGVELVQADFAREEEVG
KLIEALAVHQDLALVIHNASAFEPQAADPAAQLAQFDQFYRVHMAAPFQLNRALASQLAR
NANAGIIHITDIYIHAPAPQFASYVATKAGAHSLAMSFARELAPAVRVNTIEPGPILFLD
EHGDAWRQQVLAKTPLAREGGLEPIWQAVQLLMQNDYMTGASIRVDGGRGLAVI
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcattggtgacggggtgtggccgccggcttggtttctatctgtgcgaacagctg
gtggcggcgggttggcaggtgacgggcagctatcgcagcgagcgacccgagctggcgcgg
ctgcgagcgctgggggtcgagctggtgcaggcggatttcgcgcgcgaggaggaggtcggc
aagctgatcgaggcgctggccgtccatcaggatctggcgctggtgatccacaacgcctcg
gcgtttgagccgcaggcggcggatccggcggcgcagctggcccagtttgatcagttctac
cgggtgcacatggcggcccccttccagctaaaccgcgcgctggcgtcccagctggcgcgc
aacgccaatgccggcatcatccatatcaccgacatctacatccacgcgccggcaccccag
tttgccagctatgtggccaccaaggcgggggcccactcgctggccatgagctttgcccgc
gagctggcacccgccgtccgggtcaataccatagagccgggccccatcctgtttctcgac
gaacatggcgatgcgtggcgccagcaggtgctggcgaagacgccgctggcgcgggaaggg
gggctggagcccatctggcaggcagttcagctgttgatgcagaacgactacatgaccggg
gccagcatccgggtggatggtggccgcggtctggccgtcatctag

DBGET integrated database retrieval system