KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_4106Help
Entry
AHA_4106          CDS       T00424                                 

Gene name
galM
Definition
(RefSeq) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
aha00010  Glycolysis / Gluconeogenesis
aha00052  Galactose metabolism
aha01100  Metabolic pathways
aha01110  Biosynthesis of secondary metabolites
aha01120  Microbial metabolism in diverse environments
aha01130  Biosynthesis of antibiotics
Module
aha_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:aha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AHA_4106 (galM)
   00052 Galactose metabolism
    AHA_4106 (galM)
Enzymes [BR:aha01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AHA_4106 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 4488123
NCBI-ProteinID: YP_858530
UniProt: A0KQH9
Position
4550572..4551708
Genome map
AA seq 378 aa AA seqDB search
MPSTRPASASRPTATSAAPARGRENYEPIDDADRRPCLPDRQHRCRQTMSDAMIPFELEN
EEGLRLRGLDFGATLTSLTLPVAGGRREVLLGCADEAYPAQQVWLGAVAGRFANRIGGAE
LLRDGQRWPLDANQPPHCLHGGRAGFHRQHWQIKEREADRVRLTLLSRAGDQGFPGNLRV
TLEYRLEQCDLVVDFVASTDAATPVSLTSHTYFNLDDNPNGGDVRDHLIRLNADRFLPTD
QSGLPLALAPVEGPFDLRHERLIGQDWLSHPQQQQAKGYDHAFVLNGPSAEWAARVVSGD
RQLAMEVYTNQPSLQFYTGNWLANTPARGGRLHQDHAGFCLEAQQLPDSPNRPELGDPWL
SPGQTYRHQTRYRFIAAS
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtacccggcccgcttcggcctcaaggccgacagctacgtctgccgcgccagcg
cgggggcgggaaaactatgagcccattgatgatgcagaccgacggccatgtctgccggat
cggcaacacaggtgcaggcagactatgagcgatgccatgatcccgttcgagctggaaaac
gaggaggggctgcgcctgcgtggcctcgatttcggtgccaccctcacctccctaaccctg
ccggtggcgggcgggcgccgcgaagtgctgctgggctgcgccgatgaggcctaccccgcg
cagcaggtgtggctgggggcggtggcggggcgctttgccaaccgtatcggcggcgccgaa
ctgctgcgcgacggccagcgctggccgctggatgccaaccagccgccccactgcctgcac
ggcgggcgggcggggtttcatcgccagcactggcagatcaaggagcgggaggcggaccgg
gtcagactgaccctgctctcccgggcgggggatcagggctttcccggcaacctgcgggtc
acgctggagtaccggctggagcagtgcgatctggtggtggatttcgtcgccagcacggat
gccgcgaccccggtcagcctcaccagccacacctacttcaatctcgatgacaacccgaac
ggcggcgatgtgcgcgatcacctcatccgcctcaatgccgaccgtttcctgccgaccgac
caaagcggcctgccgctcgcgctcgcaccggtggaggggccattcgatctgcgccacgaa
cgccttatcggacaagattggctgagccacccccagcagcaacaggccaaggggtatgac
cacgccttcgtgctcaacgggccgagcgccgagtgggcggcacgggtggtctcgggggat
cgccagctggcgatggaggtctacaccaaccagccctcgctgcagttctacaccggcaac
tggctggccaatacgccggcgcgaggcggccgactccatcaggatcacgccggcttctgt
ctggaagcccagcagttgccggacagccccaaccggcccgagctgggggatccctggctg
tcgccggggcagacctatcgccaccagacccgttatcgctttatcgccgccagctga

DBGET integrated database retrieval system