KEGG   Aeromonas hydrophila subsp. hydrophila ATCC 7966: AHA_4211Help
Entry
AHA_4211          CDS       T00424                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
aha  Aeromonas hydrophila subsp. hydrophila ATCC 7966
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:aha00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4662597..4663232
Genome map
AA seq 211 aa AA seqDB search
MGTVASLDIDAQKGFTPLCPNELPVAGGDDIVAALNAQATLASLRIGSKDSHPANAAWAV
SDPAGMLLPLDLPNADLTWPVHCVPGTRGFELLDGLPAPVDYDFFVWKGVEPDLHPYGTC
FHDLAERRSTGLIEFLHARGVTTVLAGGLATDYCVKTSVLQLRRAGFRVIVHLDACRGIA
PETVASAHTQMIEAGAELAQSLIDVQRLLDA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccgtcgccagcctggatattgatgcgcagaagggctttacccccctctgcccg
aacgaactgcccgtcgcgggcggggatgatattgtggctgcgctcaacgctcaggccacc
ctcgccagcctgcggatcggcagcaaggattcgcatcccgccaacgccgcctgggccgtc
agcgatcccgccggcatgttgctgccgctggacctgcccaacgccgacctcacctggccg
gtgcactgcgtgccgggtacccgcggcttcgaactgctcgacggcctgccggccccggtc
gattacgacttcttcgtctggaagggggtcgagccggatctgcacccctacggcacctgc
ttccacgatctggccgagcgccgcagcaccggactcatcgagtttctgcacgcccgcggc
gtcactaccgtactggccggcggcctcgccaccgactactgcgtcaagaccagcgtgctg
cagctgcgccgcgccggcttccgggtgatcgtccatctcgatgcctgtcgtggcatcgcc
cccgagacggttgccagcgcccacacccagatgatcgaggccggcgccgaactcgcccag
agcctgatcgatgtacaacgcctgctggacgcctga

DBGET integrated database retrieval system