KEGG   Arcanobacterium haemolyticum: Arch_0056Help
Entry
Arch_0056         CDS       T01242                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arch_0056
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arch_0056
   00052 Galactose metabolism
    Arch_0056
   00500 Starch and sucrose metabolism
    Arch_0056
   00520 Amino sugar and nucleotide sugar metabolism
    Arch_0056
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Arch_0056
   00524 Butirosin and neomycin biosynthesis
    Arch_0056
Enzymes [BR:ahe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Arch_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
84569..85471
Genome map
AA seq 300 aa AA seqDB search
MDNHETIRIGVDIGGTTMSVARIHSGGKITERIEIPSPARISGAAVVRELRDIVTRNWPG
AASLGIGAAGVIDSHGRILTASDSFNGWAGFHLREETEAALGIPVGVENDVNAFLLGETT
CGVVAGETTCLGVMLGTGVGGAIMIDGQILHGARGAAAEIGHMPGFGTAPCTCGGNGHVE
CTSSGRSIADRYGRATGQHVPSARVVSDAARSGDHVAQEILKDAGRVVALAILQVATIVD
LSSVVIGGGVTRDWDFVSAGIAEVTSRHPLISGADLTIHKSTLGGDAVLIGAARKGELAC
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggataaccacgaaaccatccggataggcgtagacatcggcggaaccaccatgagcgtg
gcacggatacacagcggcggaaaaatcacggaacgcatagaaatccccagcccagcgcgc
atatcaggagccgcagtggtacgggaactgcgcgatatcgttacccgtaactggccgggc
gccgcctccctagggatcggcgccgccggcgtgatcgattcccacggacgcatcctcacc
gcctccgattccttcaacgggtgggccggattccacctcagggaagaaaccgaagctgcg
cttggaattcctgtgggcgtagagaacgacgtgaatgccttcctccttggcgaaaccacc
tgcggcgtggtggccggcgaaaccacctgcctaggcgtgatgctcggaaccggcgtgggc
ggagccatcatgatcgacggccagatcctccacggtgcccgcggggccgccgccgaaatc
gggcacatgccagggttcggcactgcaccatgcacatgcggcggaaacgggcatgtggaa
tgtacatcctccggccgtagcatcgcagatcgctacggccgagcgaccggccaacacgtg
ccgagcgcccgtgttgtttctgacgccgcccgatccggggatcacgtggcccaggaaatc
ctgaaggacgccggcagggtggtggcgctcgcgatcttgcaggtggccacgatcgtggat
ttgtccagcgtggtgatcggcggcggtgtaacccgtgattgggattttgtgagtgctggg
attgctgaagtgacttcgcgccatcctcttatttcaggcgctgacctgaccattcacaag
tccaccttgggtggggatgccgtgcttatcggcgccgcccgcaaaggagagttagcatgc
tga

DBGET integrated database retrieval system