KEGG   Arcanobacterium haemolyticum: Arch_0158Help
Entry
Arch_0158         CDS       T01242                                 

Definition
(GenBank) Glycoside hydrolase, family 20, catalytic core
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00511  Other glycan degradation
ahe00520  Amino sugar and nucleotide sugar metabolism
ahe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Arch_0158
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Arch_0158
Enzymes [BR:ahe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Arch_0158
Chaperones and folding catalysts [BR:ahe03110]
 Intramolecular chaperones
  Others
   Arch_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b
Motif
Other DBs
NCBI-ProteinID: ADH91921
JGI: Arch_0158
UniProt: D7BLX2
Position
complement(193718..195124)
Genome map
AA seq 468 aa AA seqDB search
MGVWVPTTTVAVVSDLAFRHEGERLASELGDRGVAAQVDEAPGVALRVILQVAAEDLATP
ETATVVVDESTIVVTASAPVGIFRATRRILAAFDETGSVPCGEFEVSPLVAERGLHIDAA
RKYVDAEWMKDRIREAAAIGLNVIQWHFSENEGFRLESEAFPQIVSEHRITRDEAREILA
LARDLYVEIIPSLDMPGHLRKALASFPHLQLPPADLAPDAEPLAIPDTGHALNIALPEAL
DFARELIDDFADLFAGCRSWHLGGDEFVDFARISEYPMLAEAAREKFGADANGFDLLTDF
VNQIGAYVKSLGFTPRVWNDGMLRGNVVGLDPDIVLTWWTNWHPDMRPVADALEANYRIV
NFNDSLFYYVLGENAGYRYPTAERIINANWHPGFFPQLPPRVSTSSNAMRTVDQTIQEIP
TIGGAYPEQLVGAFFSIWADRADAQTQEEVAAGIREPLREFAARCWAS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgtgggttccgacgacgacggtggcggtcgtttccgatttggctttccgtcac
gaaggtgagcggcttgcgtctgagctgggcgatcgtggtgtggcggcacaggttgatgag
gctccgggggtggcgcttcgggtaattttgcaggttgctgcggaagatcttgctacgcct
gagacggcaactgttgtagttgatgagtccacgattgttgtgacggcatcggcccctgtt
gggattttccgtgctacgcgccgtattttggcggcgtttgatgaaaccggttcggtgcca
tgcggggagtttgaggtttccccgctggtggctgaacgtggcttacatattgatgctgct
cgtaagtatgttgatgcggaatggatgaaggatcggatccgtgaggctgctgcgatcggt
ttgaatgttattcagtggcatttttctgagaatgaagggttccggttggaatcggaggca
ttccctcagatcgtgtcggagcatcggattacgcgtgatgaggctcgtgagattttggcg
ttggcgcgcgatctgtatgtggagatcattccgtcgttggatatgcctggccatttgcgc
aaggcgctcgcatccttccctcacttgcaacttccacctgctgatcttgcgcctgatgcg
gaaccgttggcgattcctgataccggccatgcgttgaatattgcgttgccggaggcgctt
gattttgcgcgtgagctgattgatgattttgcagatttgttcgcgggatgccgttcgtgg
catcttggtggcgatgaatttgttgatttcgctcggatttctgagtacccaatgttggca
gaggctgcccgcgaaaagtttggggcggacgcgaatggattcgatctgctcacggatttt
gtgaaccagatcggtgcctatgtgaagagtctgggctttactccgcgcgtctggaatgat
gggatgttgcgcggcaacgtggtgggcctcgatccggatatcgtgctgacctggtggact
aactggcatcctgatatgcggccggtggctgacgccttggaggccaactaccggatcgtc
aattttaacgattcgctcttctactatgtgttgggagagaacgccggttaccgctacccc
actgccgaacgtattatcaacgcgaactggcatccgggattttttccgcagttgccaccg
cgggtatcgacgtcgtcgaacgccatgcgaaccgtggatcaaacaattcaagaaatccca
actattggcggcgcgtatccagagcagctggtgggcgcgttcttctcgatttgggcggat
agggcggatgcgcagactcaagaggaagtggcggccggaatccgcgaaccgttgcgcgaa
ttcgcggcgcggtgctgggcttcctag

DBGET integrated database retrieval system