KEGG   Arcanobacterium haemolyticum: Arch_0252Help
Entry
Arch_0252         CDS       T01242                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Arch_0252
Enzymes [BR:ahe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Arch_0252
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
307209..307802
Genome map
AA seq 197 aa AA seqDB search
MSDLPKLHIGHYDEEAVVDAIKRLLIAVGEDPNRDGLLDTPDRMGRAYKEMFAGLGEDPA
DVLNTTFDIRHEELVLVRDISMYSMCEHHLLPFHGVAHIGYIPGPDGLVTGLSKLARLVE
GFARRPQVQERLTSQIVDAIMERLNAQGAIVVVEAEHLCMSMRGVKKPGSHTVTSAVRGK
LRETATRAEAMSLIMSK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctaccaaaactccacatcggccactatgatgaagaagccgtcgttgacgcc
attaagcggctacttatcgcggtaggcgaagatccaaaccgcgatgggctcctagatacg
ccggatcgcatggggcgtgcttacaaggaaatgtttgctgggcttggtgaagacccagcg
gacgtcctcaacaccaccttcgatatccgccatgaagaactcgtgctcgttcgcgatatc
tccatgtattcgatgtgcgaacaccacctgctaccattccacggagtcgcccacatcggc
tacattccagggccagacgggctcgtaaccggcctgtcaaaacttgcccgattagtagaa
ggattcgcccgccggccacaagtacaagagcggctcacctcacaaattgttgacgcgatc
atggaacgtctcaatgcgcaaggcgcgatcgtcgtcgtcgaagcagaacatctgtgcatg
tccatgcgcggcgtgaagaaaccaggatcgcacactgttacgtccgcagtacgcggaaaa
ctgcgcgaaactgccacccgagccgaggcaatgagcctcatcatgtcaaagtaa

DBGET integrated database retrieval system