KEGG   Arcanobacterium haemolyticum: Arch_0253Help
Entry
Arch_0253         CDS       T01242                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ahe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
307813..308625
Genome map
AA seq 270 aa AA seqDB search
MHIMGIVNVTPDSFSDGGKWATPETAIQHGTELMDAGATILDIGGESTRPGARALEWDEE
WERIANVIEELSRIGQERGVAVSVDTYHAETARRSVEAGASIVNDVTGGNGDPAMLATVA
KLDCDYILQHSRGTAETMNSLATYTNIVDEVVSELVAARERALAAGIDAERIILDPGLGF
AKMGDDDWNVLGGIDRVIELGHRVLVGASRKRFIGHLVGENQAHRDLSTAVISGFLAEHG
VWAARVHNVDASSVVLATLEKIQQHSKKTQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcatgggcatcgtcaacgtgaccccagattccttctctgacgggggaaaatgg
gcaactccagaaaccgcgatccagcacggaaccgaactgatggatgcgggcgcaaccatc
ctcgatatcggcggcgaatcaacccgccccggcgctcgcgcgctggaatgggatgaagaa
tgggaacgcatcgccaacgtgatcgaagaactctcacgcatcggacaagaacgcggcgtg
gccgtctcggtagatacataccacgcagaaacagcgcggcgatcggtagaagcaggcgca
tcaatcgtcaatgacgtaaccggcggaaacggtgatccggccatgctcgcaaccgtggcg
aaactcgattgcgactacattttgcaacactcgcgtggcaccgcagaaaccatgaacagc
ctggcaacatacacgaatattgtggacgaagtcgtgagtgaactcgttgccgcacgcgaa
cgtgcgttggctgcgggaattgacgccgaacgaatcatcctcgatccagggctcggtttc
gccaaaatgggagacgacgattggaacgtccttggcggaattgatcgcgtgatagaactc
gggcaccgagtgctcgtgggagcatcgcgcaaacgattcatcgggcacttggttggggaa
aatcaggcacatcgggacttatccacagccgttatctccggtttcctcgcagaacacggg
gtgtgggctgcacgtgtgcataacgttgacgcctcatctgtagttcttgctacgctggag
aaaattcagcaacacagcaagaaaacacagtag

DBGET integrated database retrieval system