KEGG   Arcanobacterium haemolyticum: Arch_0469Help
Entry
Arch_0469         CDS       T01242                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Arch_0469
Enzymes [BR:ahe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Arch_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
550472..552613
Genome map
AA seq 713 aa AA seqDB search
MPDHSLDLEKLHRLADAYNVATEFWGFNGEHVSVDQDTLIAVLAAMGVDATSNDMIEAAL
VAKEEAPWRQILPSCVVTRNDRELTVPVHVPHGWDVVLTILCEDGTERSVRQCEDFTPPR
MVEGHQIGQASFVLDEGLPLGYHTLRARVSHNETDKFAEDTTTLIVTPARLDRGSLDDKR
SWGMMAQLYSTRSAQSWGIGDTDDLLEMASLFGSMGADYLLVNPLHAAEPIEPISPSPYL
PVTRRFFNPMYIRPENIREVAYLSGPERSLVTWAAENVKKDSVKNTHIDRDSSWKAKREA
LEVIFKAGRSQSRDREFAQYRHNEGQGLEDFALWCALVEHYEGRPFPEDLKDIHGRAVAK
ARTALKERVDFWAWLQWVMDEQLADAQRAAKAAGMAFGVAHDLAVGVHPAGSDTWTIPEA
FARGIGVGAPPDMYNQQGQNWSQPPWRPDALERMDYAPLRDMARTVLRHAGVLRVDHVMG
LFRLWWIPDGSPASRGTYVRFNHDAMVGILLLEAYRAGAVVVGEDLGNVEPWVRDYLSDR
GMWGTSIFWFEKDEQGNPLRAEDYRYGALVSVDTHDLPPAAGYLAEEHVDLRARLGLLVE
AEEEVRAQARHERETVYARLREYGLIGDDPSEREVIEAIHVYLAKTPSPLLCISLVDAVG
ERRAQNQPGTDQEYANWKIPLADGTEKVVLVEELATNPRLISLVETFTKALNS
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgccagatcactcgcttgatcttgaaaaactacatcggctagcagacgcctacaatgtt
gctaccgaattttggggctttaacggcgaacacgtttccgtagatcaagacaccctgatt
gcagtgcttgccgcgatgggcgtggatgcaacctcaaatgacatgattgaagccgcgttg
gttgcgaaggaagaagcgccatggcgtcagattctcccatcgtgcgtggttacccggaat
gatcgtgaactcacggttcctgttcatgtgccgcacggctgggatgttgtgctcacgatc
ctgtgtgaggatggaacggagcgctctgtccgccagtgtgaagatttcactcctccacgc
atggtggaggggcatcagattggccaggcaagtttcgtgttggatgaaggtctgccactg
ggctaccacacgttgcgtgctcgcgtgagccacaatgagacggacaagtttgctgaagat
accaccacattgatcgttaccccagcccgcttggatcgcggttcgttggatgacaagcgg
tcgtgggggatgatggctcagctctactccacgcgttctgctcaatcgtgggggattggc
gatactgacgatcttctggaaatggcttcgttgttcggttcgatgggcgcggattacctg
ttagtgaacccgcttcatgcggctgaaccgattgaaccgatttcaccgtcgccatatttg
cctgtgactcgccgtttcttcaacccgatgtatattcggccggagaacatccgtgaagtt
gcctacctttcagggccggagcgttcgctggttacgtgggctgcggaaaatgtgaagaag
gattcggttaagaatacgcatattgatcgtgattcttcgtggaaggcgaagcgtgaagcg
cttgaggtgattttcaaggctggccgttcccaatcgcgtgatcgtgaattcgcccagtac
cgccataatgaaggccagggcttggaagatttcgcgttgtggtgtgcgttggttgaacac
tacgaagggcgcccattccctgaagatctgaaggatattcatggccgcgccgtggcgaag
gctcgtacagcgctcaaggaacgtgtggatttctgggcgtggcttcagtgggttatggat
gagcagttggcggacgcgcagcgtgccgctaaggctgccggtatggcgtttggtgttgcg
cacgatttggctgtgggggttcacccggcaggttccgatacgtggactattcctgaagcg
ttcgcacgcggtattggggttggtgctccaccggacatgtacaatcagcagggccagaac
tggtctcagccgccgtggcgtccggatgcgctggagcgtatggattatgctccgttgcgt
gatatggcacgtacggtgttgcgtcacgcgggcgtgttgcgtgttgatcacgtgatgggc
ctgttccgtttgtggtggattccggatggctcgccggcaagccgcggtacatatgttcgt
tttaatcacgacgcgatggttggcattttgctcctggaagcttatcgcgctggcgctgtt
gtggttggcgaagatttgggtaacgtggagccgtgggttcgcgattatttgagtgatcgg
ggcatgtggggtacgtcgattttctggttcgaaaaagacgaacaggggaatccgttgcgt
gccgaagattaccgttacggtgcgttggtttcagttgatacgcatgatcttccaccggct
gcaggctatttggctgaggagcacgttgatttgcgtgctcggcttggtttgttggttgaa
gcggaggaagaagttcgcgcacaggcacgccacgaacgcgagaccgtctacgcacggttg
cgtgaatacggtttgattggtgacgatccgtccgaacgcgaagttatcgaagcgatacac
gtgtatttggctaagacgccgtcacctttgttgtgtatttcgcttgtcgacgccgttggg
gagcgccgcgctcagaaccagcctggcactgaccaagagtatgctaactggaagattcca
ctggcggatggtaccgaaaaagttgtgttggttgaggagctcgcaaccaacccacggttg
atttcgcttgttgaaaccttcacgaaggctctcaatagctag

DBGET integrated database retrieval system