KEGG   Arcanobacterium haemolyticum: Arch_0605Help
Entry
Arch_0605         CDS       T01242                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00900  Terpenoid backbone biosynthesis
ahe01100  Metabolic pathways
ahe01110  Biosynthesis of secondary metabolites
ahe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Arch_0605
Enzymes [BR:ahe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Arch_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADH92341
JGI: Arch_0605
UniProt: D7BN42
Position
687191..688414
Genome map
AA seq 407 aa AA seqDB search
MRDVIVLGSTGSIGTQTLDVISRHRDSFRVRALGAGGSRIDVLVAQAHDFDVPVVGLAND
AAVATFRSVWNDAYGSVSMPDLVVGPDAMTNLAGLGSGTSDSSDVVVNGITGSVGLLPTL
AALRSGATLALANKESLVVGGGLVADAMAWPGQIVPVDSEHSAIAQALRSGRHRKGLTSP
IVDGTSEVSRIILTASGGPFRGKKRSDLENVTAKAALNHPTWAMGPVVTVNSSTLMNKGL
ELIEAAYLFDVAPEQIVPVVHPQSVIHSMVEFQDGSTIAQASPPDMRLPIALGISWPERL
TNVATPNAWDAPVSWTFEPLDHDVFPAVKMARAAVASSPLHPAVLNAANEECVDAFLAGN
LPYLGIIDTVRDVLDTISIPAERDVETVLDMERRARMLAHKLMRTRN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgacgttattgttcttggttccaccggttcgattggcacccagaccctcgacgtc
atctcccgccaccgcgattcgtttcgcgtgcgtgcgttgggtgctggcggttcgcgtatc
gatgtgctcgtggcgcaggcccacgatttcgatgttccggttgttggtttagcgaacgac
gccgccgtggctacgttccgttccgtatggaacgatgcgtacggttcggtttccatgcct
gaccttgttgttggccctgatgccatgacgaaccttgctggcctggggagcggcacaagc
gattcttctgacgtggtggtgaatggaattaccggatcggttggtttgcttcctacgttg
gccgcgcttcgttctggtgctacgttggcgttggcgaataaggaatcgttggttgttggc
ggcggcctggttgccgacgcaatggcgtggcctggccaaatcgtgcccgttgattcggaa
cattccgcaatagcgcaagcgttgcgttccggccggcaccgcaaaggcctaacctcaccg
atcgttgacggcaccagcgaagtatcccgaatcatcttgaccgcctccggcggcccgttc
cgcggtaaaaagcgtagcgatctagaaaatgtgacagctaaagccgcattgaatcacccc
acatgggctatggggccagttgttaccgtcaattcgtctaccttgatgaacaaaggcctg
gaactgatcgaagccgcctacctctttgacgttgcgccagaacagatcgttcccgttgtc
cacccacaatccgtcatccactccatggtggaattccaagacggatctacgatcgcccag
gcgtcgccaccggatatgaggctcccgatcgcgctgggcatctcctggccagaacgactc
accaacgtagcaaccccgaacgcatgggacgctcccgtatcgtggaccttcgaacctctc
gatcatgacgtgttcccggcagtcaagatggcccgcgccgccgtcgcgtcgtcgccactc
catcctgccgtactcaacgccgcaaacgaagagtgcgtagacgctttcctcgcaggaaac
ctgccgtatctgggaataatcgatacggtacgcgacgtacttgataccatctcaatccct
gcggaacgcgacgtcgaaacggtgcttgatatggaacggcgcgcccgcatgctcgcccac
aaactcatgcgcacgcgaaactaa

DBGET integrated database retrieval system