KEGG   Arcanobacterium haemolyticum: Arch_0722Help
Entry
Arch_0722         CDS       T01242                                 

Definition
glycoside hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Arch_0722
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Arch_0722
Enzymes [BR:ahe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Arch_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
817938..820685
Genome map
AA seq 915 aa AA seqDB search
MRIPLRKIGSCATVALCATALAIPAWAVDEKDSQDQLHGSGLTGVVPAVRQLTESQGKPW
MLSSETKIVAPQELADDARQLALDLAIKGNIHPEVAVGSESLADEGDVILSVDPQLAGVP
KDEGYRLKISDKQVKIIGKSAQGAFWGTRTLVQSVANSRGAQAGEVTDWPDVSERSFHLD
AARKFYDIHFFRELIREMSYHKLNTLQYHFSENEGFRLEPADARFKNLLSEDGYITREQL
KEILAEAHKYHIEVVPALDMPGHLRHILDKHPEFRLPTTNGSGAQNPNSEMRRGLDFTNP
EAVAFMKDLVADYAKAFPGTKWHLGSDEFVDFPKAAMHYPDMMKRIKDNAKLGEGKNFAD
GFVYFINDMAAYMKTLGKTDIRVWNDAFYRNDLKQNIELDKNITIDYWTAWDRHMADVKD
FVDKGYRLINYNDAYMYYVLYYPGRAYSTRVPADKIHNEFHAGRFPTNHHKTQSSWPQDA
PKKASNTQYPDWLTGASFAVWSDNAKLETQEEVLKNSKMPYVAFANRVWYAGDSRDYAQF
AAAEQKIAPAPAVPSNLKVGVKTHLASQTDVQKAVKKGDKVTFTGKVTNTSSEKVPVNVT
LNAKESFGTINPDNVTTKILDKDGHPIVLPGKNVALASAGAKATASSTEAAQFGPEKTID
GKISAESRWASQYKDGEWLNVTLAKATDITKVRLGWEGAYATDYTVEISHQNGKTTTYKR
QNFDGKGAGKNTAAWDDITLSATEGKDVTAIKIIADKRKTEWGASLFEVEALTAERQAAP
SAPILTPDGDLVWQENLEPGSSLELTWAGIATHNSSSANPLKAQLRGQAHYGAIATAEDT
SDITYTVGNDEPAPEPKPEPAPKPVPQPDPTNTKVIKNPAMKTGGLAHTGASVLGLVGLA
IAAGIGGTLLTRRKK
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccccttacgaaaaattggtagttgcgcaaccgttgcactgtgtgcaaccgca
ttggctattccagcgtgggctgttgacgaaaaagactcgcaggatcagcttcatggtagt
gggttgactggagttgttccagcagttcgccaacttacggagagtcaggggaagccctgg
atgctttccagcgaaacaaagattgtggcgcctcaagagttagcagacgacgctcgccag
ctcgctttagaccttgcaatcaagggaaatattcaccctgaagtagctgtgggtagtgaa
tcgcttgctgacgaaggggatgtgatcttatcggttgatcctcagttggccggtgttcca
aaggatgaaggctatcggctaaagatttcagataagcaggtgaaaattattggcaagagc
gctcaaggggcgttctggggcacccgcacgcttgtacaatcggttgcgaattcacgtgga
gcgcaggcaggtgaggtgacggattggcctgatgtttctgaacgttcgttccatctggat
gcggcgcgtaagttttacgatatccatttcttccgtgagttgattcgtgagatgagttat
cacaagctcaatacgttgcagtatcatttttcggaaaatgaggggttccgcttggaacct
gcggatgctcggtttaagaatctgctttctgaggatggctacattacgcgcgagcaatta
aaggagattcttgcggaggctcacaagtaccatattgaggttgttccggcgttggatatg
ccagggcatttgcggcatattttggataagcatccggagtttagattgccgacgacgaac
ggttctggagcgcaaaatcctaacagtgagatgcggcgtggtttagacttcacgaatcct
gaagcggttgccttcatgaaggatcttgttgccgattacgcgaaggcttttcctggtacg
aagtggcatctaggttcggatgaatttgttgatttccctaaagcggctatgcattatcca
gacatgatgaagcgtattaaggataatgcgaagctcggtgaagggaagaattttgctgat
ggcttcgtgtatttcattaacgacatggctgcatacatgaagacgttagggaagaccgat
attcgggtttggaacgatgccttttatcgtaacgatcttaaacagaacattgagctggat
aaaaacatcacgatcgattactggactgcttgggataggcatatggccgacgtgaaagat
tttgttgacaagggctaccggttaatcaactacaacgatgcctacatgtactacgtgctg
tattatccgggaagagcttacagtacccgagttcctgcagataagatccataacgaattc
cacgcgggccgtttcccaacgaaccaccataagacgcaatcgtcctggccacaggatgcc
ccaaagaaagctagtaatacacagtacccggattggcttaccggagcatcgtttgccgtc
tggtctgacaacgcgaaactcgaaacacaagaagaagtgctaaaaaactcaaagatgcca
tacgtggctttcgctaaccgagtctggtatgcgggagatagtcgagactacgcacagttc
gctgcagctgaacaaaagattgccccagctccggcagtcccatccaacctcaaagtaggc
gtaaaaactcaccttgcttcccaaaccgacgttcagaaagcagtgaagaaaggcgataaa
gtcacattcacgggtaaggtaaccaatacgtcgtcggaaaaagtcccggtaaacgtaacc
ctcaacgcgaaagaatccttcggaaccattaaccccgataacgtaacaacgaagatactc
gataaagacggacacccgattgtccttcctgggaagaacgtagcgcttgccagcgctgga
gcgaaagcaacggcgtcatcgaccgaagcagcccagttcggcccagaaaaaacgatcgac
gggaaaattagtgcggagtcccggtgggcatcccaatataaagacggcgagtggctaaac
gtgaccctagcgaaagcaaccgatattactaaggtgcggcttggctgggaaggcgcatac
gcaaccgattatacagttgaaatctcacatcaaaatgggaaaacaacaacgtataaacgc
caaaacttcgacggtaaaggagcaggcaaaaacacagccgcctgggacgacattacccta
agcgctacagaaggaaaagacgtcaccgcaattaaaatcattgcagacaaacgcaaaaca
gaatggggagcttcgcttttcgaagtcgaagcacttaccgccgaacgccaggctgcgccc
tccgctccaatactcacccctgacggcgacctcgtatggcaagaaaacctcgaaccagga
agctcactggaactaacctgggccggaatcgcaacccacaactctagctccgctaatccg
ttgaaagcccaacttcgaggccaagcccactacggtgcaatcgccactgctgaagacacg
agcgatattacctatacggtaggaaacgacgaaccggcgcccgaacctaaacctgaaccg
gcgcccaagcctgtgccgcaaccagatccaacgaacacgaaagtcatcaaaaatcctgcc
atgaaaacaggcggacttgcccacaccggcgcaagtgtacttggcctagtaggcctcgca
atagccgccggaatcggaggaactcttctaacacgccgtaagaaatag

DBGET integrated database retrieval system