KEGG   Arcanobacterium haemolyticum: Arch_0722Help
Entry
Arch_0722         CDS       T01242                                 

Definition
(GenBank) Glycoside hydrolase, family 20, catalytic core
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00511  Other glycan degradation
ahe00520  Amino sugar and nucleotide sugar metabolism
ahe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Arch_0722
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Arch_0722
Enzymes [BR:ahe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Arch_0722
Chaperones and folding catalysts [BR:ahe03110]
 Intramolecular chaperones
  Others
   Arch_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 Glyco_hydro_20b F5_F8_type_C Trypan_PARP Glycohydro_20b2 GHL6
Motif
Other DBs
NCBI-ProteinID: ADH92454
JGI: Arch_0722
UniProt: D7BNF5
Position
817938..820685
Genome map
AA seq 915 aa AA seqDB search
MRIPLRKIGSCATVALCATALAIPAWAVDEKDSQDQLHGSGLTGVVPAVRQLTESQGKPW
MLSSETKIVAPQELADDARQLALDLAIKGNIHPEVAVGSESLADEGDVILSVDPQLAGVP
KDEGYRLKISDKQVKIIGKSAQGAFWGTRTLVQSVANSRGAQAGEVTDWPDVSERSFHLD
AARKFYDIHFFRELIREMSYHKLNTLQYHFSENEGFRLEPADARFKNLLSEDGYITREQL
KEILAEAHKYHIEVVPALDMPGHLRHILDKHPEFRLPTTNGSGAQNPNSEMRRGLDFTNP
EAVAFMKDLVADYAKAFPGTKWHLGSDEFVDFPKAAMHYPDMMKRIKDNAKLGEGKNFAD
GFVYFINDMAAYMKTLGKTDIRVWNDAFYRNDLKQNIELDKNITIDYWTAWDRHMADVKD
FVDKGYRLINYNDAYMYYVLYYPGRAYSTRVPADKIHNEFHAGRFPTNHHKTQSSWPQDA
PKKASNTQYPDWLTGASFAVWSDNAKLETQEEVLKNSKMPYVAFANRVWYAGDSRDYAQF
AAAEQKIAPAPAVPSNLKVGVKTHLASQTDVQKAVKKGDKVTFTGKVTNTSSEKVPVNVT
LNAKESFGTINPDNVTTKILDKDGHPIVLPGKNVALASAGAKATASSTEAAQFGPEKTID
GKISAESRWASQYKDGEWLNVTLAKATDITKVRLGWEGAYATDYTVEISHQNGKTTTYKR
QNFDGKGAGKNTAAWDDITLSATEGKDVTAIKIIADKRKTEWGASLFEVEALTAERQAAP
SAPILTPDGDLVWQENLEPGSSLELTWAGIATHNSSSANPLKAQLRGQAHYGAIATAEDT
SDITYTVGNDEPAPEPKPEPAPKPVPQPDPTNTKVIKNPAMKTGGLAHTGASVLGLVGLA
IAAGIGGTLLTRRKK
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccccttacgaaaaattggtagttgcgcaaccgttgcactgtgtgcaaccgca
ttggctattccagcgtgggctgttgacgaaaaagactcgcaggatcagcttcatggtagt
gggttgactggagttgttccagcagttcgccaacttacggagagtcaggggaagccctgg
atgctttccagcgaaacaaagattgtggcgcctcaagagttagcagacgacgctcgccag
ctcgctttagaccttgcaatcaagggaaatattcaccctgaagtagctgtgggtagtgaa
tcgcttgctgacgaaggggatgtgatcttatcggttgatcctcagttggccggtgttcca
aaggatgaaggctatcggctaaagatttcagataagcaggtgaaaattattggcaagagc
gctcaaggggcgttctggggcacccgcacgcttgtacaatcggttgcgaattcacgtgga
gcgcaggcaggtgaggtgacggattggcctgatgtttctgaacgttcgttccatctggat
gcggcgcgtaagttttacgatatccatttcttccgtgagttgattcgtgagatgagttat
cacaagctcaatacgttgcagtatcatttttcggaaaatgaggggttccgcttggaacct
gcggatgctcggtttaagaatctgctttctgaggatggctacattacgcgcgagcaatta
aaggagattcttgcggaggctcacaagtaccatattgaggttgttccggcgttggatatg
ccagggcatttgcggcatattttggataagcatccggagtttagattgccgacgacgaac
ggttctggagcgcaaaatcctaacagtgagatgcggcgtggtttagacttcacgaatcct
gaagcggttgccttcatgaaggatcttgttgccgattacgcgaaggcttttcctggtacg
aagtggcatctaggttcggatgaatttgttgatttccctaaagcggctatgcattatcca
gacatgatgaagcgtattaaggataatgcgaagctcggtgaagggaagaattttgctgat
ggcttcgtgtatttcattaacgacatggctgcatacatgaagacgttagggaagaccgat
attcgggtttggaacgatgccttttatcgtaacgatcttaaacagaacattgagctggat
aaaaacatcacgatcgattactggactgcttgggataggcatatggccgacgtgaaagat
tttgttgacaagggctaccggttaatcaactacaacgatgcctacatgtactacgtgctg
tattatccgggaagagcttacagtacccgagttcctgcagataagatccataacgaattc
cacgcgggccgtttcccaacgaaccaccataagacgcaatcgtcctggccacaggatgcc
ccaaagaaagctagtaatacacagtacccggattggcttaccggagcatcgtttgccgtc
tggtctgacaacgcgaaactcgaaacacaagaagaagtgctaaaaaactcaaagatgcca
tacgtggctttcgctaaccgagtctggtatgcgggagatagtcgagactacgcacagttc
gctgcagctgaacaaaagattgccccagctccggcagtcccatccaacctcaaagtaggc
gtaaaaactcaccttgcttcccaaaccgacgttcagaaagcagtgaagaaaggcgataaa
gtcacattcacgggtaaggtaaccaatacgtcgtcggaaaaagtcccggtaaacgtaacc
ctcaacgcgaaagaatccttcggaaccattaaccccgataacgtaacaacgaagatactc
gataaagacggacacccgattgtccttcctgggaagaacgtagcgcttgccagcgctgga
gcgaaagcaacggcgtcatcgaccgaagcagcccagttcggcccagaaaaaacgatcgac
gggaaaattagtgcggagtcccggtgggcatcccaatataaagacggcgagtggctaaac
gtgaccctagcgaaagcaaccgatattactaaggtgcggcttggctgggaaggcgcatac
gcaaccgattatacagttgaaatctcacatcaaaatgggaaaacaacaacgtataaacgc
caaaacttcgacggtaaaggagcaggcaaaaacacagccgcctgggacgacattacccta
agcgctacagaaggaaaagacgtcaccgcaattaaaatcattgcagacaaacgcaaaaca
gaatggggagcttcgcttttcgaagtcgaagcacttaccgccgaacgccaggctgcgccc
tccgctccaatactcacccctgacggcgacctcgtatggcaagaaaacctcgaaccagga
agctcactggaactaacctgggccggaatcgcaacccacaactctagctccgctaatccg
ttgaaagcccaacttcgaggccaagcccactacggtgcaatcgccactgctgaagacacg
agcgatattacctatacggtaggaaacgacgaaccggcgcccgaacctaaacctgaaccg
gcgcccaagcctgtgccgcaaccagatccaacgaacacgaaagtcatcaaaaatcctgcc
atgaaaacaggcggacttgcccacaccggcgcaagtgtacttggcctagtaggcctcgca
atagccgccggaatcggaggaactcttctaacacgccgtaagaaatag

DBGET integrated database retrieval system