KEGG   Arcanobacterium haemolyticum: Arch_0735Help
Entry
Arch_0735         CDS       T01242                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arch_0735
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arch_0735
  Amino acid metabolism
   00310 Lysine degradation
    Arch_0735
Enzymes [BR:ahe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Arch_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(835021..836715)
Genome map
AA seq 564 aa AA seqDB search
MSEEIKMPALGESVNEGTVTTWLKQVGEYVEADEPIVEVSTDKVDTEVPAPAAGILEKIV
VNEDETVDVGTILGYIGDGSADAPAANDGSGEGSEPLPQAEAEAAAPERETPAPAGGGEG
VEVLMPALGESVNEGTVTTWLKQVGDTVEEDEPIVEVSTDKVDTEVPAPAAGVITKIIVN
EDDTVEVGTVLAIIGGSVEEAAPAATPAAAPAPEAPAAPATPAPAAAPVATPAAAPVPAA
GDDGKSSYVTPIVRKLAKDLGVDLASVSGTGVGGRVRRQDVEAAAEAAKAASAVAPAAPA
PATPATPAADGSVKSALASKAQEAATKRGTRQKMTGLRKTVAKRMVESLETSAQLTTVME
VDVTRIVKLRAAAKDGFLAREGVKLTFLPFFIQAATEALKAHPIINSSVEGNEIVYHNVE
HVGIAVDTPKGLFVPVIKNCGDLNIAGISKAVGDLAARTRDGKVGSDELTGSTFTITNTG
SIGALFDTPIINQPNVAIMGTGAIFKAPAVVKDQDGNEVISIRSKCYLSISYDHRIVDGA
DASRYLRDVKLRLEEADFAGELGL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaaattaagatgcccgccctgggcgaatccgtaaatgaaggaaccgtcacc
acctggctcaagcaggttggcgaatacgttgaagctgacgaaccaatcgttgaagtctcc
accgataaggttgacaccgaagttccagctccagcagcaggcatcctcgaaaagatcgtt
gttaatgaagacgaaaccgttgatgtaggaaccattcttggctacattggcgatggttcc
gccgatgctccagcagcaaacgatggttctggcgaaggttccgaaccactcccacaggct
gaagctgaagccgcagctccagaacgcgaaaccccagctcctgccggcggtggcgaaggc
gttgaagtcctcatgccggcactcggtgaatccgtgaacgaaggcaccgttaccacctgg
ctcaagcaggttggcgataccgttgaagaagacgaaccaatcgttgaagtctccaccgat
aaggttgacaccgaagttccagctccagcagcaggcgttatcaccaagatcatcgtgaat
gaagatgacactgttgaagttggcaccgtgttggcaatcatcggcggctctgttgaagaa
gcagctccagcggctactcctgccgctgctcccgctcctgaagcaccagctgctccagca
actccagctccagcggctgccccagttgctaccccagcggctgcaccagttcctgctgca
ggcgatgacggcaagtcctcctatgtgactccaatcgttcgtaagttggctaaggatctc
ggcgttgatctggcatccgtttccggtaccggcgttggcggccgtgttcgccgccaggat
gtggaagccgcagcagaagccgctaaggctgcctctgcagttgcaccagccgctccggct
ccagctactccagctactccagccgctgatggttcggtcaagtccgctttggcgtccaag
gctcaggaagccgcaaccaagcgtggcacccgccagaagatgactggccttcgtaagacc
gttgccaagcgcatggttgaatcgctcgaaacctcggctcagctcaccactgtgatggaa
gttgacgtcacccgtatcgttaagctccgcgctgcagctaaggatggcttcttggctcgc
gaaggtgtcaagctcaccttcctgccattcttcatccaggcagcaaccgaagcattgaag
gcacacccaatcatcaactcctctgttgaaggtaacgaaatcgtttaccacaacgttgaa
cacgttggtatcgcagtggatacgccaaagggtctcttcgttccagtcatcaagaactgt
ggcgatctgaacattgcgggcatctccaaggctgttggcgatctcgcagctcgtacccgt
gatggcaaggttggctccgatgaacttaccggctccaccttcactatcaccaacaccggt
tcgatcggcgctctcttcgacaccccgatcatcaaccagccaaacgtggcaatcatgggt
accggcgcaatcttcaaggctccagcagtcgtgaaggatcaggatggcaacgaagttatc
tccatccgttccaaatgctacctctctatctcctacgatcaccgtatcgttgatggcgca
gatgcttcccgttacctccgtgacgtcaagctccgcttggaagaagcagatttcgcaggt
gagcttggcctctga

DBGET integrated database retrieval system