KEGG   Arcanobacterium haemolyticum: Arch_0735Help
Entry
Arch_0735         CDS       T01242                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ahe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ahe00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ahe00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(835021..836715)
Genome map
AA seq 564 aa AA seqDB search
MSEEIKMPALGESVNEGTVTTWLKQVGEYVEADEPIVEVSTDKVDTEVPAPAAGILEKIV
VNEDETVDVGTILGYIGDGSADAPAANDGSGEGSEPLPQAEAEAAAPERETPAPAGGGEG
VEVLMPALGESVNEGTVTTWLKQVGDTVEEDEPIVEVSTDKVDTEVPAPAAGVITKIIVN
EDDTVEVGTVLAIIGGSVEEAAPAATPAAAPAPEAPAAPATPAPAAAPVATPAAAPVPAA
GDDGKSSYVTPIVRKLAKDLGVDLASVSGTGVGGRVRRQDVEAAAEAAKAASAVAPAAPA
PATPATPAADGSVKSALASKAQEAATKRGTRQKMTGLRKTVAKRMVESLETSAQLTTVME
VDVTRIVKLRAAAKDGFLAREGVKLTFLPFFIQAATEALKAHPIINSSVEGNEIVYHNVE
HVGIAVDTPKGLFVPVIKNCGDLNIAGISKAVGDLAARTRDGKVGSDELTGSTFTITNTG
SIGALFDTPIINQPNVAIMGTGAIFKAPAVVKDQDGNEVISIRSKCYLSISYDHRIVDGA
DASRYLRDVKLRLEEADFAGELGL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaaattaagatgcccgccctgggcgaatccgtaaatgaaggaaccgtcacc
acctggctcaagcaggttggcgaatacgttgaagctgacgaaccaatcgttgaagtctcc
accgataaggttgacaccgaagttccagctccagcagcaggcatcctcgaaaagatcgtt
gttaatgaagacgaaaccgttgatgtaggaaccattcttggctacattggcgatggttcc
gccgatgctccagcagcaaacgatggttctggcgaaggttccgaaccactcccacaggct
gaagctgaagccgcagctccagaacgcgaaaccccagctcctgccggcggtggcgaaggc
gttgaagtcctcatgccggcactcggtgaatccgtgaacgaaggcaccgttaccacctgg
ctcaagcaggttggcgataccgttgaagaagacgaaccaatcgttgaagtctccaccgat
aaggttgacaccgaagttccagctccagcagcaggcgttatcaccaagatcatcgtgaat
gaagatgacactgttgaagttggcaccgtgttggcaatcatcggcggctctgttgaagaa
gcagctccagcggctactcctgccgctgctcccgctcctgaagcaccagctgctccagca
actccagctccagcggctgccccagttgctaccccagcggctgcaccagttcctgctgca
ggcgatgacggcaagtcctcctatgtgactccaatcgttcgtaagttggctaaggatctc
ggcgttgatctggcatccgtttccggtaccggcgttggcggccgtgttcgccgccaggat
gtggaagccgcagcagaagccgctaaggctgcctctgcagttgcaccagccgctccggct
ccagctactccagctactccagccgctgatggttcggtcaagtccgctttggcgtccaag
gctcaggaagccgcaaccaagcgtggcacccgccagaagatgactggccttcgtaagacc
gttgccaagcgcatggttgaatcgctcgaaacctcggctcagctcaccactgtgatggaa
gttgacgtcacccgtatcgttaagctccgcgctgcagctaaggatggcttcttggctcgc
gaaggtgtcaagctcaccttcctgccattcttcatccaggcagcaaccgaagcattgaag
gcacacccaatcatcaactcctctgttgaaggtaacgaaatcgtttaccacaacgttgaa
cacgttggtatcgcagtggatacgccaaagggtctcttcgttccagtcatcaagaactgt
ggcgatctgaacattgcgggcatctccaaggctgttggcgatctcgcagctcgtacccgt
gatggcaaggttggctccgatgaacttaccggctccaccttcactatcaccaacaccggt
tcgatcggcgctctcttcgacaccccgatcatcaaccagccaaacgtggcaatcatgggt
accggcgcaatcttcaaggctccagcagtcgtgaaggatcaggatggcaacgaagttatc
tccatccgttccaaatgctacctctctatctcctacgatcaccgtatcgttgatggcgca
gatgcttcccgttacctccgtgacgtcaagctccgcttggaagaagcagatttcgcaggt
gagcttggcctctga

DBGET integrated database retrieval system