KEGG   Arcanobacterium haemolyticum: Arch_0735Help
Entry
Arch_0735         CDS       T01242                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00020  Citrate cycle (TCA cycle)
ahe00310  Lysine degradation
ahe01100  Metabolic pathways
ahe01110  Biosynthesis of secondary metabolites
ahe01120  Microbial metabolism in diverse environments
ahe01130  Biosynthesis of antibiotics
ahe01200  Carbon metabolism
Module
ahe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arch_0735
  Amino acid metabolism
   00310 Lysine degradation
    Arch_0735
Enzymes [BR:ahe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Arch_0735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ADH92467
JGI: Arch_0735
UniProt: D7BNG8
Position
complement(835021..836715)
Genome map
AA seq 564 aa AA seqDB search
MSEEIKMPALGESVNEGTVTTWLKQVGEYVEADEPIVEVSTDKVDTEVPAPAAGILEKIV
VNEDETVDVGTILGYIGDGSADAPAANDGSGEGSEPLPQAEAEAAAPERETPAPAGGGEG
VEVLMPALGESVNEGTVTTWLKQVGDTVEEDEPIVEVSTDKVDTEVPAPAAGVITKIIVN
EDDTVEVGTVLAIIGGSVEEAAPAATPAAAPAPEAPAAPATPAPAAAPVATPAAAPVPAA
GDDGKSSYVTPIVRKLAKDLGVDLASVSGTGVGGRVRRQDVEAAAEAAKAASAVAPAAPA
PATPATPAADGSVKSALASKAQEAATKRGTRQKMTGLRKTVAKRMVESLETSAQLTTVME
VDVTRIVKLRAAAKDGFLAREGVKLTFLPFFIQAATEALKAHPIINSSVEGNEIVYHNVE
HVGIAVDTPKGLFVPVIKNCGDLNIAGISKAVGDLAARTRDGKVGSDELTGSTFTITNTG
SIGALFDTPIINQPNVAIMGTGAIFKAPAVVKDQDGNEVISIRSKCYLSISYDHRIVDGA
DASRYLRDVKLRLEEADFAGELGL
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaaattaagatgcccgccctgggcgaatccgtaaatgaaggaaccgtcacc
acctggctcaagcaggttggcgaatacgttgaagctgacgaaccaatcgttgaagtctcc
accgataaggttgacaccgaagttccagctccagcagcaggcatcctcgaaaagatcgtt
gttaatgaagacgaaaccgttgatgtaggaaccattcttggctacattggcgatggttcc
gccgatgctccagcagcaaacgatggttctggcgaaggttccgaaccactcccacaggct
gaagctgaagccgcagctccagaacgcgaaaccccagctcctgccggcggtggcgaaggc
gttgaagtcctcatgccggcactcggtgaatccgtgaacgaaggcaccgttaccacctgg
ctcaagcaggttggcgataccgttgaagaagacgaaccaatcgttgaagtctccaccgat
aaggttgacaccgaagttccagctccagcagcaggcgttatcaccaagatcatcgtgaat
gaagatgacactgttgaagttggcaccgtgttggcaatcatcggcggctctgttgaagaa
gcagctccagcggctactcctgccgctgctcccgctcctgaagcaccagctgctccagca
actccagctccagcggctgccccagttgctaccccagcggctgcaccagttcctgctgca
ggcgatgacggcaagtcctcctatgtgactccaatcgttcgtaagttggctaaggatctc
ggcgttgatctggcatccgtttccggtaccggcgttggcggccgtgttcgccgccaggat
gtggaagccgcagcagaagccgctaaggctgcctctgcagttgcaccagccgctccggct
ccagctactccagctactccagccgctgatggttcggtcaagtccgctttggcgtccaag
gctcaggaagccgcaaccaagcgtggcacccgccagaagatgactggccttcgtaagacc
gttgccaagcgcatggttgaatcgctcgaaacctcggctcagctcaccactgtgatggaa
gttgacgtcacccgtatcgttaagctccgcgctgcagctaaggatggcttcttggctcgc
gaaggtgtcaagctcaccttcctgccattcttcatccaggcagcaaccgaagcattgaag
gcacacccaatcatcaactcctctgttgaaggtaacgaaatcgtttaccacaacgttgaa
cacgttggtatcgcagtggatacgccaaagggtctcttcgttccagtcatcaagaactgt
ggcgatctgaacattgcgggcatctccaaggctgttggcgatctcgcagctcgtacccgt
gatggcaaggttggctccgatgaacttaccggctccaccttcactatcaccaacaccggt
tcgatcggcgctctcttcgacaccccgatcatcaaccagccaaacgtggcaatcatgggt
accggcgcaatcttcaaggctccagcagtcgtgaaggatcaggatggcaacgaagttatc
tccatccgttccaaatgctacctctctatctcctacgatcaccgtatcgttgatggcgca
gatgcttcccgttacctccgtgacgtcaagctccgcttggaagaagcagatttcgcaggt
gagcttggcctctga

DBGET integrated database retrieval system