KEGG   Arcanobacterium haemolyticum: Arch_0769Help
Entry
Arch_0769         CDS       T01242                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ahe00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
872266..872913
Genome map
AA seq 215 aa AA seqDB search
MAELVFFSGTMDCGKSTLALQTAYNYEQRGLGGIIFAMKDRAGHGKLSSRLGLETDAIEV
TPETNFWEAVGKARQNGERVDFIICDEVQFYSREQVDQLARIVDEIHISVWGFGITTDFL
TRLFPGSARMLELADRVERLQVEALCWCGKRATHNARTINGMMVTEGEQVMVGDTKRGDV
VGYEVLCRYHHMHGMTAASEHASEISPTPLTLGSH
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggctgagctcgtgttcttctcaggcacgatggattgtggcaaatcaacgcttgctttg
cagaccgcctacaactacgaacaacgtggtttaggaggcatcatcttcgcgatgaaagat
cgtgccgggcacggaaaactctcctcccggcttgggctggaaactgacgccatcgaagtg
acccccgaaacgaacttctgggaagccgttggaaaagcgcgccaaaacggcgaacgcgtg
gactttattatctgtgacgaagtgcagttctatagccgtgaacaggtggatcaactcgcg
cgaatcgtggacgaaatccacatcagcgtgtggggttttggcatcactactgacttcctt
acacggcttttcccgggttcggcacgcatgctcgaacttgcagatcgtgtggaacggctc
caagtagaagccctgtgctggtgtggaaaacgagcaacacacaacgctcgtaccatcaac
ggaatgatggtgactgaaggagaacaggtgatggtaggcgataccaaacgcggagacgta
gtgggatacgaagtgctctgccgctaccatcacatgcacggcatgactgccgcatcggaa
cacgccagcgaaatctctccgactccgctgacgctcggatcacactga

DBGET integrated database retrieval system