KEGG   Arcanobacterium haemolyticum: Arch_0781Help
Entry
Arch_0781         CDS       T01242                                 

Definition
type III site-specific deoxyribonuclease (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
ahe  Arcanobacterium haemolyticum
Brite
Enzymes [BR:ahe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Arch_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
882118..885084
Genome map
AA seq 988 aa AA seqDB search
MKFQFDPRQPYQTSAIEAVTDLFDGQPADAEQLLTSLQYLPPQQTRDLPDVGGQEAFDVF
LEIGAYGNNLVLDEGTILENLRRIQDRNGLEINDGLVDGLQFDIEMETGTGKTYVYLRTA
FELAAKYKFTKFIILVPSVAIREGVRTSIQLMREHFRHLYPQINMDYTVYSGDRAEDVRD
FATGTSLQFMVMTIDSIRGDKNTRIIHQQRDKLSGLRPLDYVQATRPIVMMDEPQNMESL
LAQSAVADLNPLCTLRYSATHRMTRNVVYRLDPLDAHRLELVKKIVVSDALELGSAAKPY
VKLLEVKRDPTFKAVLELMCRKKDGSYAKRKVTATQGADLERLSGGNLAYEGNWRINEIS
VLPEQIELSNFGYLRVGEEIGGNQDAVFREMIRETIREHIRKEIQVHERGIKVLSLFFID
KVASYLGEGINNLDADGEFAQAFDAIYEEERAKNEASHAFLPADPVEARSGYFAQMKRGK
GKAAQMTFKDSSGKTKADDDAYELIMKDKARLLSMGEPVRFIFSHSALREGWDNPNVFQI
CTLRDMTSETERRQTIGRGLRLPVDQDGERVKDSGIAQLTVVANESYTAFAAALQDEYKR
AGVAVGYVRRTEFAELPIVEDGKESRLGTRRSAEIWESLHERGYINAAGEVMGTWVPDQL
GFTVGLPEEFEGYEDEVIRIVDGCKIESLVKPKRKRVTRTLNKQVYATPEFEQFWEKITA
RTTYRVSLDRADLVERCVASIKQAPPIDPIRIQVTRTGLEITRGGPKGCELGSRSAVLTD
SYPLPDIILQLQESTSLTRKTIIDILLGSGRIGEFLTNPNDFIKMVTERIETELAHTLIE
GIQYEPIGGSIYELRELQADGLEEKDRFIDQMYKVTNKDKTDFDYLVLDSAVERQFAQYV
DGREDIKLFMKLPDKFRIPTPVGDYNPDWAIIKIEDGVDRLYLVRETKSSQDPKKRRPSE
NAKITAAIKHFEAIGVNYAVSSPERWTI
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atgaaattccagtttgacccgcgccagccgtaccaaaccagtgcgatcgaggccgtcact
gacctgttcgatgggcaaccagctgacgcggaacagcttctgaccagcctgcagtatctt
ccgccccagcagacgcgcgatttaccagatgtcggtggtcaggaagccttcgacgttttc
ttagagattggtgcgtatggcaacaatcttgttctggacgagggtacgatccttgagaat
cttcgtcggattcaggatcggaatggtctggagatcaacgatggtctggttgatgggttg
cagttcgatattgagatggagactggtacgggtaagacgtatgtttatttgcgcacggcg
ttcgagttggcggcgaagtataagttcactaagtttattattttggtgccgtcggtggcg
attcgtgagggtgtgaggaccagtattcagttgatgcgggagcacttccgtcacttgtat
ccgcagattaacatggactataccgtgtattcgggtgaccgggctgaggatgtgcgtgat
tttgcgacgggtacgtctttgcagttcatggtgatgacgattgattcgatccgtggtgat
aagaatactcgtattattcaccagcagcgcgataagttgtctggtttgcgtccgttggat
tatgtgcaggcgactcgtccgattgtgatgatggatgagccgcagaacatggagtctttg
cttgcgcagtctgctgtggctgatctgaacccgttgtgtacgttgcggtattcggcaact
caccgtatgacccgcaacgtcgtgtaccggctcgatccactcgatgcgcatcggctggag
ctggtgaaaaagattgtcgtctcggatgctcttgagcttgggagtgcggctaaaccgtat
gtgaagctgctcgaggttaaacgtgacccgaccttcaaagcggtccttgagttgatgtgt
cgtaagaaggacggctcgtacgcgaaacgtaaagtgaccgcgactcaaggggcggacctg
gagcggctctctggcggtaacctggcgtatgaggggaattggcggatcaacgagatcagc
gtgttgcctgagcagattgagctgagtaacttcgggtatctgcgcgtaggggaagagatt
ggcggtaaccaggatgcggtattccgcgagatgatccgcgagaccatccgtgagcacatc
cgcaaggaaatccaggttcacgagcgcggcattaaagtgttgtcgttgttcttcattgac
aaggtcgcctcttatctgggtgagggtatcaataaccttgacgcggacggtgagttcgcg
caggctttcgacgcgatctatgaagaagaacgagccaagaacgaagcctcccatgcgttc
ttacctgccgatccggttgaggcaaggtcgggctattttgctcagatgaagcggggcaag
ggcaaggctgctcagatgacgttcaaggattcatcgggcaagacgaaggctgatgatgat
gcttatgagttgattatgaaggataaggcccgcctgctgagcatgggtgagccggttcgg
ttcatcttctcccattcagcgcttcgtgaggggtgggataacccgaacgtgttccagatt
tgcacgctgcgtgacatgacctcagaaacggagcgccgtcagacgatcgggcgcggtttg
cgcttgccagttgatcaggatggtgagcgcgtcaaggactcaggaatcgcacagttgacg
gtggttgccaatgagtcgtacacggcgttcgctgctgcgttgcaggacgagtacaagcgt
gccggtgttgccgttggttacgtgcgtaggactgagtttgctgagctgccgatcgttgag
gacggtaaggaatcccgccttggcacgcgccgctccgctgaaatctgggagtccttgcat
gagcgcggttacatcaacgcggcaggtgaagtcatgggcacgtgggttcccgatcagctc
ggtttcactgtcggactgcctgaagagttcgagggttatgaagatgaggtgattcgcatc
gttgacggatgcaagatcgaatccctggtcaagcctaagcgtaagcgtgtgacccggact
ttgaacaagcaggtctatgccaccccagagtttgaacagttctgggagaagatcacggcg
cgcacgacctaccgggtgagtttggaccgtgccgatctggtcgagcggtgtgtggccagc
atcaagcaagccccaccaatcgatccgatccgtatccaggtgactcgtacggggcttgag
attacccggggtgggccgaaaggttgtgaactggggtctcgttcggcggtgctcacggat
tcgtacccgttgccggacattatcttgcagctccaggaatccacatcgctgacccgtaaa
acgatcatcgacattctgctgggttcggggcgtatcggtgaattcctgaccaacccgaat
gatttcatcaagatggtcaccgagcgcatcgagaccgagcttgctcacaccctcattgaa
gggatccagtatgagccgatcggtgggagcatctatgagttgcgtgagctccaggccgat
ggacttgaagagaaggaccggttcatcgaccagatgtacaaggtgaccaacaaggacaag
accgactttgactaccttgtgcttgattcagccgtagaacgccagttcgcgcagtatgtg
gatgggcgtgaggacattaagttgttcatgaaactgcccgacaagttccgtatcccaaca
cctgttggtgactataacccggactgggcgatcatcaagatcgaagatggggtcgatcgg
ctttatttggttcgtgagacgaagtcgagccaggacccaaagaagcgtcgcccatctgag
aatgcgaagatcacggcagcgatcaagcacttcgaagctatcggggtgaactatgcggtg
agttctccggaacgctggacaatctaa

DBGET integrated database retrieval system