KEGG   Arcanobacterium haemolyticum: Arch_0822Help
Entry
Arch_0822         CDS       T01242                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Arch_0822
Enzymes [BR:ahe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Arch_0822
DNA repair and recombination proteins [BR:ahe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Arch_0822
    RecFOR pathway proteins
     Arch_0822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH Transposase_20
Motif
Other DBs
NCBI-ProteinID: ADH92548
JGI: Arch_0822
UniProt: D7BNP9
Position
930200..930799
Genome map
AA seq 199 aa AA seqDB search
MIASLRGIVSAIGITSAVIEVGGVGMSVQATPTTLSTLRMGAEAHLMTSLIVREDSLTLY
GFGDIDERDVFDILTGISGIGPRTALAVLAVLTPDALRDAVATKNEAALTRVSGIGKKGA
QRMILELGSKLGPTRGSATASGADTRVVPADADVLEALVNLGWNEREAAPAVHEATNKMP
GASVAELLRAALQILGSRR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgcaagtctgcgtggaatagttagtgctattggcattacatcggcagtaattgag
gttggtggcgttgggatgagcgtgcaggccacccctacaacgttgagcacgttgcgtatg
ggcgctgaagctcatcttatgacctccctgatagtccgcgaagattcacttactctttat
ggtttcggtgatatcgatgaacgcgatgtttttgatattctcactgggattagcggaatc
gggccgcgtactgctctggctgttttagctgtgttaactcctgatgctttacgtgatgct
gttgctacaaagaatgaagcggctttaactcgcgtatcgggtattggcaaaaagggtgcc
caacgtatgattcttgaactgggctccaaacttgggcctacgcgggggagcgctacggct
agtggagccgatacgcgcgtggtgcctgctgatgcggatgttctagaagccctcgttaac
ttgggctggaatgaacgcgaagccgccccggcggttcacgaagcaacgaataaaatgcct
ggtgcttctgtggcagaacttctacgtgccgctttacagattctaggtagcaggagataa

DBGET integrated database retrieval system