KEGG   Arcanobacterium haemolyticum: Arch_0853Help
Entry
Arch_0853         CDS       T01242                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Arch_0853
Enzymes [BR:ahe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Arch_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
968127..968699
Genome map
AA seq 190 aa AA seqDB search
MTQIHGQAFVVCGPTAVGKGTVLKEVLAQDSGLWYSVSATTRAPRPGEIDGVHYYFVTPE
KFDELVATGGMLEWAVVHKIHRYGTPRQPVEEAMAAGKNVILELDLDGARQVRKAMPEAR
QVFIAPPSWEELEGRLKGRATESEEEQHRRLDTARTELAAQDEFDDVIVNDTVANATAAL
LSILTSSAVK
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgactcagattcacggacaagctttcgttgtatgtggccccactgctgttggtaaggga
acggtccttaaggaagttctcgcacaggattcgggcttgtggtattcggtttctgcaact
acccgggcgcctcgcccaggggaaatcgatggggttcactactactttgtcacgccagaa
aaatttgatgaactcgttgctactggtgggatgcttgaatgggccgttgtgcacaagatc
catcgctatggaactccgcgccagcctgttgaagaagcaatggctgccggcaagaacgtc
attcttgagcttgatcttgatggtgcacgccaagtccgtaaggcaatgccagaagcgcgt
caggttttcatcgctccaccgtcatgggaagaactagaaggccgcctgaaagggcgcgct
accgaatctgaagaagaacagcatcgcaggctagataccgcgcgtactgaactcgcagcc
caagatgaattcgatgacgtgatcgtgaacgatacagtggctaatgccaccgcggcgcta
ctgagtattcttaccagttccgcggtaaaataa

DBGET integrated database retrieval system