KEGG   Arcanobacterium haemolyticum: Arch_0882Help
Entry
Arch_0882         CDS       T01242                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arch_0882
   01230 Biosynthesis of amino acids
    Arch_0882
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arch_0882
   00051 Fructose and mannose metabolism
    Arch_0882
   00562 Inositol phosphate metabolism
    Arch_0882
Enzymes [BR:ahe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arch_0882
Exosome [BR:ahe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arch_0882
  Exosomal proteins of bladder cancer cells
   Arch_0882
  Exosomal proteins of melanoma cells
   Arch_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1000366..1001145)
Genome map
AA seq 259 aa AA seqDB search
MARTPIMAGNWKMNLDHLEATALVQKLGWTLNDLKHDFSAVECVVVPPFTDIRSVQTLVD
SEDFKITYGAQDVSINDEGAFTGEISTGMLTKLGVTYVVVGHSERREYHGETNELIGKKA
KKVLDAGMTPIVCCGEALEIRKEGTHVEYVLGQIAAMFADLSAEEVAKLVIAYEPIWAIG
TGEVATPADAQEVCGAIRGKIAEMFDAPTAEAVRIQYGGSVKSSNVVEIMAQPDVDGALV
GGASLKAEEFAKIVTFQQA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaccccaattatggctggcaactggaagatgaacctcgatcacctcgaggcc
accgctcttgtccagaagctaggttggaccctcaacgatctcaagcacgatttctctgca
gttgagtgtgttgttgttccaccattcacagacatccgttctgtccagactctggttgat
tctgaagacttcaagatcacctacggcgcacaggatgtttctatcaacgatgagggcgca
ttcaccggcgaaatctccaccggcatgctcaccaagcttggcgtcacctacgttgttgtt
ggacactctgagcgccgtgaataccacggcgaaaccaacgaactgattggcaagaaggcc
aagaaggttctggatgctggcatgaccccaatcgtctgctgtggtgaagcactggagatc
cgcaaggaaggtactcacgttgagtacgttctgggccagatcgctgctatgttcgctgat
ctttccgcagaagaagttgcaaagctcgttattgcttacgaaccaatctgggcaatcggc
accggcgaagttgcaaccccagctgacgcccaggaagtttgtggcgctatccgtggcaag
atcgctgagatgttcgacgccccaactgctgaagcagttcgcattcagtacggtggctcc
gttaagtcctcgaacgttgttgagatcatggcacagccagatgttgatggtgcactcgtt
ggcggcgcatccctcaaagctgaagagtttgcaaagatcgtaactttccagcaggcatga

DBGET integrated database retrieval system