KEGG   Arcanobacterium haemolyticum: Arch_0882Help
Entry
Arch_0882         CDS       T01242                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00010  Glycolysis / Gluconeogenesis
ahe00051  Fructose and mannose metabolism
ahe00562  Inositol phosphate metabolism
ahe01100  Metabolic pathways
ahe01110  Biosynthesis of secondary metabolites
ahe01120  Microbial metabolism in diverse environments
ahe01130  Biosynthesis of antibiotics
ahe01200  Carbon metabolism
ahe01230  Biosynthesis of amino acids
Module
ahe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ahe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arch_0882
   00051 Fructose and mannose metabolism
    Arch_0882
   00562 Inositol phosphate metabolism
    Arch_0882
Enzymes [BR:ahe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Arch_0882
Exosome [BR:ahe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Arch_0882
  Exosomal proteins of bladder cancer cells
   Arch_0882
  Exosomal proteins of melanoma cells
   Arch_0882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Desulfoferrod_N
Motif
Other DBs
NCBI-ProteinID: ADH92608
JGI: Arch_0882
UniProt: D7BNV9
Position
complement(1000366..1001145)
Genome map
AA seq 259 aa AA seqDB search
MARTPIMAGNWKMNLDHLEATALVQKLGWTLNDLKHDFSAVECVVVPPFTDIRSVQTLVD
SEDFKITYGAQDVSINDEGAFTGEISTGMLTKLGVTYVVVGHSERREYHGETNELIGKKA
KKVLDAGMTPIVCCGEALEIRKEGTHVEYVLGQIAAMFADLSAEEVAKLVIAYEPIWAIG
TGEVATPADAQEVCGAIRGKIAEMFDAPTAEAVRIQYGGSVKSSNVVEIMAQPDVDGALV
GGASLKAEEFAKIVTFQQA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtaccccaattatggctggcaactggaagatgaacctcgatcacctcgaggcc
accgctcttgtccagaagctaggttggaccctcaacgatctcaagcacgatttctctgca
gttgagtgtgttgttgttccaccattcacagacatccgttctgtccagactctggttgat
tctgaagacttcaagatcacctacggcgcacaggatgtttctatcaacgatgagggcgca
ttcaccggcgaaatctccaccggcatgctcaccaagcttggcgtcacctacgttgttgtt
ggacactctgagcgccgtgaataccacggcgaaaccaacgaactgattggcaagaaggcc
aagaaggttctggatgctggcatgaccccaatcgtctgctgtggtgaagcactggagatc
cgcaaggaaggtactcacgttgagtacgttctgggccagatcgctgctatgttcgctgat
ctttccgcagaagaagttgcaaagctcgttattgcttacgaaccaatctgggcaatcggc
accggcgaagttgcaaccccagctgacgcccaggaagtttgtggcgctatccgtggcaag
atcgctgagatgttcgacgccccaactgctgaagcagttcgcattcagtacggtggctcc
gttaagtcctcgaacgttgttgagatcatggcacagccagatgttgatggtgcactcgtt
ggcggcgcatccctcaaagctgaagagtttgcaaagatcgtaactttccagcaggcatga

DBGET integrated database retrieval system