KEGG   Arcanobacterium haemolyticum: Arch_1079Help
Entry
Arch_1079         CDS       T01242                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ahe03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1218071..1218925)
Genome map
AA seq 284 aa AA seqDB search
MPELPEVETVRAGLVPHVVGKTIERADLLHSRVARMSEFGLEPVVGATISAVVRRGKYLW
MVTEAGALVAHLGMSGQFRINSNSKHLRARIHFTDGTALDFVDQRTFGHLHPDRLVATGD
GGPGGMGSDLALIPQSAAHIGRDLLDPHCDIYSVARQVKRGRTEIKRVMLNQNIASGIGN
IYADEALWEARVHPKKITSAMTLTQIRDVYEAARDVMAAALAVGGTSFDSLYVNVNGESG
YFDRSLNVYGKTGCACERCGTQIERLVFMNRSSHVCPACQRRSL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccggaagtcgaaaccgttcgcgcggggctcgttccgcacgtcgttgga
aaaaccatcgaacgtgcggacctgttgcattcgcgtgtggcgcgaatgtctgaattcggg
ctcgaacccgttgttggtgcaactatttccgctgttgtacggcgcggaaagtacttgtgg
atggtcacggaagccggggcactcgtggctcacttgggaatgtccgggcaattccgtatc
aacagtaattcgaagcatctgcgggcgcgcattcactttactgatggaacggcactcgat
tttgtagaccaacgcacgttcgggcatctgcacccggatcggcttgttgcaacaggagat
ggcgggcccggcggaatgggcagcgatttggcgttgattccgcaaagcgcagcgcatatt
gggcgtgatctgctagatccgcactgcgatatttatagcgtggcacggcaggtgaaacgt
gggcgaactgaaattaagcgggtcatgctgaaccaaaatattgcctctggaatcggcaat
atctacgctgatgaggccttgtgggaagcgcgtgtgcatccgaagaagatcacgtcggct
atgacgttgactcagatacgggatgtgtatgaggccgcccgggacgtgatggcggcggca
ctggccgtgggtggaacgtccttcgattcgctctatgtaaacgttaacggagaatcggga
tattttgatcgttcgttgaacgtgtatgggaaaactggatgcgcatgtgaacgatgcggc
acacagatcgaacggttagttttcatgaaccgttcgtcccacgtgtgcccggcatgtcag
cggcgttcgttgtaa

DBGET integrated database retrieval system