KEGG   Arcanobacterium haemolyticum: Arch_1094Help
Entry
Arch_1094         CDS       T01242                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ahe00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ahe00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1231561..1232883)
Genome map
AA seq 440 aa AA seqDB search
MSGVLKVTGGQPLHGTITVRGAKNFVSKAMVAALLTEETSILRNVPLIRDVDVVSDLLRL
HGADVDYDQEAGIVTITPGKIHLPEDPAEMDRLAGSSRIPILFCGPLLHALGEAFIPDLG
GCHIGDRPVDFHLQVLEDFGAVRDVQELGLHLTAPRGLRARKVTLPYPSVGATEQTLLAA
VRADGITELRGAAVEPEIMDLISVLQKMGALITVSTDRTIVIEGVRELHGYNHFALADRI
EAGSWACAALATGGNIMVQGAQQEPMMSFLNVFRKVGGEFDVTDNGIRFWHPGGRLNSIP
IETDVHPGFMTDWQQPFVVALTQATGVSIVHETVYENRFGFVGALNQMGAHIQVYRECLG
GKKCRFGTENFYHSAVIMGPTPLKAADITVPDLRGGFSHLIAALAAEGTSHVQGIDLINR
GYEHFMTKLRALHANVERVS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcgttttgaaagtgactggcgggcaaccgctacacggaaccattacagtgcgc
ggagctaaaaacttcgtgtcaaaagcaatggtcgctgcgcttctcactgaagaaacatcc
atccttcgcaatgtcccactcattcgcgatgttgatgtggtgtcagatttacttcgcctt
catggtgcggatgtggattatgatcaagaagcaggcatcgtaaccatcacgcctggaaag
atccatttgccagaagatccggcggaaatggatcgcttggcaggatcgtcacgtattcca
attcttttttgtggcccgttgctccacgcgctaggagaagccttcatcccagatctaggt
ggttgccacatcggagatcgcccagtggattttcacctccaagtactcgaagatttcgga
gcagtacgggatgttcaagaactcgggcttcacctcactgctccccgtggcctcagggca
cgcaaagttacacttccatacccttctgtgggggctacagaacaaactctgctcgctgcc
gttcgtgccgatggcattaccgagcttcggggtgctgcggtagaaccagaaatcatggat
ctcatctctgtcttgcagaagatgggcgctcttatcactgtctccacagatcgcacgatc
gtgatcgaaggtgttcgtgaactccacggctacaaccattttgcgttagcagatcgtatc
gaagcgggatcgtgggcatgtgcagccctagctaccggcggaaatattatggttcaaggc
gcacaacaagaaccaatgatgagcttcctcaacgtcttccgtaaagttggtggcgaattt
gacgtgacagacaacggcatccgtttctggcacccaggaggcaggctcaactcgatcccc
attgaaacagacgttcatccagggtttatgactgactggcaacaacccttcgtcgtcgcc
ctcactcaagcaacaggtgtatccatcgttcacgaaaccgtttacgaaaaccgatttgga
ttcgtcggtgccctcaaccaaatgggtgcacatatccaagtttatcgtgaatgtttaggc
ggaaaaaaatgccgtttcggtacggaaaacttttaccattcagcagtgatcatggggcca
acgccacttaaagccgcagacatcaccgtgccagatctccgtggcggtttttcccacctg
atcgcggcgctcgcggccgaaggtacctcgcacgtccaaggaatcgatctgatcaaccgc
ggctacgaacacttcatgaccaagctccgtgcattacatgcaaacgttgaacgagtctcc
taa

DBGET integrated database retrieval system