KEGG   Arcanobacterium haemolyticum: Arch_1266Help
Entry
Arch_1266         CDS       T01242                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.2 2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Arch_1266
Enzymes [BR:ahe01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Arch_1266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1398766..1400055)
Genome map
AA seq 429 aa AA seqDB search
MAEKFDVVDVIRSKRDKSKLTKEEIDWTIDAYTRGVVGDEQMAALAMAIFLNGMDREEIS
QWTNAMIESGERMDFSGLGRITADKHSTGGVGDKITLPLAPLVAVYGVAVPQLSGRGLGH
TGGTLDKLEAIPGWRAALSNEEIMHQLGLEGPGAVICAAGSGLAPADKKLYALRDVTSTV
DCIPLIASSIMSKKIAEGTHSLVLDVKVGSGAFMKDLAKAQELARTMVDLGTDAGVKTTA
LLTDMSTPLGLKIGNGLEVAESVEVLAGGGPADVVELTLALAREMLTAAGQPDADIEAAL
KDGRAMDVWRSMIEAQGGDPDAAMPVAKHTHDVVAEADGVLSKLDALSVGVASWRLGAGR
AFKDEPVQLAAGIELFAKPGDEVKKGQKLMTLHTDDDTRIERALESLNGGIEIGGEFTAR
ESVVLDRIS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaagttcgacgtcgttgacgtcatccgttccaagcgtgacaagtccaagcta
accaaggaagaaatcgactggaccatcgatgcttacactcgtggagttgttggtgacgaa
caaatggcagcacttgccatggccatcttcctcaacggcatggaccgtgaagaaatctcc
cagtggaccaacgccatgatcgaatccggcgaacggatggatttctccggcctgggccgc
atcactgcagacaaacactccaccggtggcgtaggcgataagattacgctcccactcgca
ccactcgtggcagtctacggcgtggcagttccgcagctctccggccgtggcctcggccac
actggcggtacgctcgataagcttgaagctatcccaggttggcgtgcagctctctccaac
gaagagatcatgcaccagcttggccttgaaggcccaggtgctgttatctgtgcagcaggc
tccggccttgccccagcagataagaagctatacgcactgcgtgatgtcacctcaacagtg
gattgcatcccgctcatcgcatcctcgatcatgtctaagaagatcgctgaaggcacccac
tcgctcgtactcgatgtcaaggttggctccggcgccttcatgaaggaccttgccaaggca
caagaactcgcacgtaccatggttgatcttggtactgatgcaggcgtgaagacaacggct
ctcctcaccgacatgtccaccccactcggcctcaagatcggaaacggcctggaagtcgca
gaatcagtggaagtcctggccggtggcggcccagctgacgtcgtcgaactcacccttgca
cttgcacgcgaaatgctcaccgcagcaggtcagccagatgcggacatcgaagcggcactc
aaggatggacgtgcaatggacgtatggcgttcgatgatcgaagcacaaggcggagatcca
gacgccgcaatgccagttgccaagcacacccacgacgtggttgcagaagccgatggcgtg
ctttccaagctcgacgcactctccgtaggcgtagcttcctggcgcctcggtgcaggccgc
gcattcaaggatgagccggtccagcttgcagcaggaatcgaactgtttgcgaagccaggc
gacgaagtcaagaaaggtcaaaagctcatgaccctccacaccgacgacgacacccgtatc
gaacgagccctcgaatccctcaacggtggaatcgaaatcggcggcgaatttacagcccgt
gaatccgttgttctcgaccggatttcctga

DBGET integrated database retrieval system