KEGG   Arcanobacterium haemolyticum: Arch_1291Help
Entry
Arch_1291         CDS       T01242                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00010  Glycolysis / Gluconeogenesis
ahe00030  Pentose phosphate pathway
ahe00051  Fructose and mannose metabolism
ahe00052  Galactose metabolism
ahe00680  Methane metabolism
ahe01100  Metabolic pathways
ahe01110  Biosynthesis of secondary metabolites
ahe01120  Microbial metabolism in diverse environments
ahe01130  Biosynthesis of antibiotics
ahe01200  Carbon metabolism
ahe01230  Biosynthesis of amino acids
ahe03018  RNA degradation
Module
ahe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arch_1291
   00030 Pentose phosphate pathway
    Arch_1291
   00051 Fructose and mannose metabolism
    Arch_1291
   00052 Galactose metabolism
    Arch_1291
  Energy metabolism
   00680 Methane metabolism
    Arch_1291
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Arch_1291
Enzymes [BR:ahe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Arch_1291
Protein phosphatases and associated proteins [BR:ahe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Arch_1291
Messenger RNA biogenesis [BR:ahe03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Arch_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADH92996
JGI: Arch_1291
UniProt: D7BK16
Position
1426393..1428687
Genome map
AA seq 764 aa AA seqDB search
MLDISAKLSEAERAERPKIGVLTSGGDAQGMNAVVRAVVRTALHAGAIPFALHEGWKGAI
EGGDLIQELSWSSVSGILSKGGTAIGTARSDEFRERSGLKKVVRNLAQRGIDRLVVVGGD
GTLTGADELREFWPELLAELVEEGEITPEAGERHKHLRIAGVVGSIDNDLVGTDMTIGAD
SALHRIIEAIDAIAATAASHQRTFIIEVMGRACGYLALMSAIAGGCDYVFIPELPPEDGW
EEAMTTKLRTGRERGRRDSLIILAEGALDRSGNPITATQVADVIKERLGEDARITSLGHV
QRGGQPTAYDRWMPTLLGYTAALDMVNAGPETQPTIIGTKRNRIVRMPMMEAVANTRKVK
AYLKEGNWEGAIDSRGASFREMITIFEAMSSPTTNTTGCCDGGSPRVGIIHAGGLAPGMN
PAARAAVKLGIDRGYTMIGIDGGFPGLLEGHTRVLEWGDVEGWAEDGGAELGTRRTIPDV
DQYYALSRAIENAELDALIVIGGFKGYKMAYDMGQEKDRYPGFNIPIVCIPASIDNNLPG
SEHAIGADTALNTNVETLDKIRTSASASQRCFVAETMGRNTGYLALFSAISSGAEQVYLA
ETGITLPQLAEDTQRMINAFEHGRHLYLVIRNEDASEYYTTDFLGRIFEEEGHKLFDVRT
SVIGHAQQGGNPSPFDRTMAARIVNSAINVLDDELRTRVKNSRSFHIGMVDGVIQAMPLS
HMGDLIDMEARTQFEPWWLPLRHVVNVVSDPTYAGPLEDLAIVQ
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgctggatatatcagcaaaactcagcgaagcagagcgcgccgagcgcccaaagatcgga
gtcctcacatctggaggggatgcccaaggcatgaacgccgtcgttcgcgccgtcgttcgc
acagcgctccacgccggagctatcccgttcgcactccacgaaggctggaaaggcgccatc
gaaggcggcgatctgatccaagaactctcctggtcatcagtctccggaatcctttccaaa
ggcggaacggcaatcggaacggccagatcagatgagttccgcgagcgctccgggctcaaa
aaagtcgtacgcaacttggcacaacggggaatcgatcgcctcgtcgtcgtcggtggggac
ggaaccctcacgggcgcggatgaactgcgcgaattctggccagaactcctagcggaactc
gtagaagaaggagaaattaccccggaagcaggcgaacgccacaagcacctacgtatcgcg
ggcgttgttggatcaatcgataatgacctggtgggaaccgatatgactatcggcgccgat
tccgcgctccaccgcatcatcgaagcaatcgacgccatcgccgcaaccgcagcctcccac
caacgcaccttcattatcgaagtgatggggcgcgcgtgcggatacctcgcgctcatgtct
gcaatcgcaggcggctgcgactacgtgtttatcccagaactcccgccagaagatggctgg
gaagaagccatgaccacgaaactgcgcacgggccgcgaacggggccgccgcgattcgctc
attattcttgcggaaggcgcgctggaccgttccggaaacccaatcacggcaacgcaagta
gcggacgtcatcaaagaacgtctgggcgaagatgcccggattacatcgctcggccacgtg
caacgcggcggccagccaaccgcctacgatcgctggatgccaacgctgctcggctacacg
gccgcactcgatatggtgaacgccggccccgaaacgcaacccacgatcatcggcacaaaa
cgcaaccggatcgtccgcatgcccatgatggaagccgtagcgaatactcgcaaggtcaag
gcatacctgaaagaaggcaactgggaaggcgcgatcgattcgcgtggcgcttctttccgc
gaaatgatcacgattttcgaagccatgtcctcccccaccacaaacactacgggctgctgc
gatggcggttcgccgcgcgtgggtatcatccacgcgggcggcctggcgccgggcatgaat
cctgcggcgcgcgcagccgtgaagctgggtattgatcgcggatacacgatgattgggatc
gacggcggtttccctggtttgcttgaaggccacacgcgcgttctcgaatggggcgacgtg
gagggctgggccgaagatggcggcgccgagcttggcacccgccgcacgattcctgacgtg
gatcagtattacgccctatcccgcgcgatcgaaaatgcggaacttgatgcgctcatcgta
atcggcggtttcaagggttacaagatggcttacgatatgggccaggagaaggaccgctat
cctgggtttaatattccgattgtgtgtatcccggcatcgattgacaacaatttgcctggt
tccgagcatgcgattggtgcagatactgcgttgaatacgaacgtggaaacgttggataag
attcgcacgtctgcttctgcatcgcaacggtgtttcgttgcggaaacgatggggcgcaac
acgggctatttggcattgttctctgcgatttcttcgggcgccgaacaggtgtatttggct
gaaacggggatcacgttgccgcaacttgcggaggatacccagcggatgattaacgcgttc
gaacacgggcgtcacctgtatttggtgattcgtaatgaggatgcgtccgaatactacacc
accgatttcttggggcggattttcgaagaagaagggcacaagcttttcgatgttcgcacg
tccgttatcggccacgcccagcagggcgggaacccgtcgcctttcgatcgtacgatggcc
gcacgtatcgtgaattctgcgatcaacgttctcgacgacgaacttcgcactcgcgttaaa
aactcacgttcgttccatattggcatggttgatggggttatccaggctatgccgctttct
cacatgggcgatctgattgatatggaggcgcgcacgcagttcgaaccatggtggttgccg
ttgcgtcacgtggtgaacgtggtgtctgatccaacctacgctggaccgttggaggatctg
gcgatcgtgcagtag

DBGET integrated database retrieval system