KEGG   Arcanobacterium haemolyticum: Arch_1291Help
Entry
Arch_1291         CDS       T01242                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arch_1291
   01230 Biosynthesis of amino acids
    Arch_1291
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arch_1291
   00030 Pentose phosphate pathway
    Arch_1291
   00051 Fructose and mannose metabolism
    Arch_1291
   00052 Galactose metabolism
    Arch_1291
  Energy metabolism
   00680 Methane metabolism
    Arch_1291
Enzymes [BR:ahe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Arch_1291
Protein phosphatases and associated proteins [BR:ahe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Arch_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1426393..1428687
Genome map
AA seq 764 aa AA seqDB search
MLDISAKLSEAERAERPKIGVLTSGGDAQGMNAVVRAVVRTALHAGAIPFALHEGWKGAI
EGGDLIQELSWSSVSGILSKGGTAIGTARSDEFRERSGLKKVVRNLAQRGIDRLVVVGGD
GTLTGADELREFWPELLAELVEEGEITPEAGERHKHLRIAGVVGSIDNDLVGTDMTIGAD
SALHRIIEAIDAIAATAASHQRTFIIEVMGRACGYLALMSAIAGGCDYVFIPELPPEDGW
EEAMTTKLRTGRERGRRDSLIILAEGALDRSGNPITATQVADVIKERLGEDARITSLGHV
QRGGQPTAYDRWMPTLLGYTAALDMVNAGPETQPTIIGTKRNRIVRMPMMEAVANTRKVK
AYLKEGNWEGAIDSRGASFREMITIFEAMSSPTTNTTGCCDGGSPRVGIIHAGGLAPGMN
PAARAAVKLGIDRGYTMIGIDGGFPGLLEGHTRVLEWGDVEGWAEDGGAELGTRRTIPDV
DQYYALSRAIENAELDALIVIGGFKGYKMAYDMGQEKDRYPGFNIPIVCIPASIDNNLPG
SEHAIGADTALNTNVETLDKIRTSASASQRCFVAETMGRNTGYLALFSAISSGAEQVYLA
ETGITLPQLAEDTQRMINAFEHGRHLYLVIRNEDASEYYTTDFLGRIFEEEGHKLFDVRT
SVIGHAQQGGNPSPFDRTMAARIVNSAINVLDDELRTRVKNSRSFHIGMVDGVIQAMPLS
HMGDLIDMEARTQFEPWWLPLRHVVNVVSDPTYAGPLEDLAIVQ
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgctggatatatcagcaaaactcagcgaagcagagcgcgccgagcgcccaaagatcgga
gtcctcacatctggaggggatgcccaaggcatgaacgccgtcgttcgcgccgtcgttcgc
acagcgctccacgccggagctatcccgttcgcactccacgaaggctggaaaggcgccatc
gaaggcggcgatctgatccaagaactctcctggtcatcagtctccggaatcctttccaaa
ggcggaacggcaatcggaacggccagatcagatgagttccgcgagcgctccgggctcaaa
aaagtcgtacgcaacttggcacaacggggaatcgatcgcctcgtcgtcgtcggtggggac
ggaaccctcacgggcgcggatgaactgcgcgaattctggccagaactcctagcggaactc
gtagaagaaggagaaattaccccggaagcaggcgaacgccacaagcacctacgtatcgcg
ggcgttgttggatcaatcgataatgacctggtgggaaccgatatgactatcggcgccgat
tccgcgctccaccgcatcatcgaagcaatcgacgccatcgccgcaaccgcagcctcccac
caacgcaccttcattatcgaagtgatggggcgcgcgtgcggatacctcgcgctcatgtct
gcaatcgcaggcggctgcgactacgtgtttatcccagaactcccgccagaagatggctgg
gaagaagccatgaccacgaaactgcgcacgggccgcgaacggggccgccgcgattcgctc
attattcttgcggaaggcgcgctggaccgttccggaaacccaatcacggcaacgcaagta
gcggacgtcatcaaagaacgtctgggcgaagatgcccggattacatcgctcggccacgtg
caacgcggcggccagccaaccgcctacgatcgctggatgccaacgctgctcggctacacg
gccgcactcgatatggtgaacgccggccccgaaacgcaacccacgatcatcggcacaaaa
cgcaaccggatcgtccgcatgcccatgatggaagccgtagcgaatactcgcaaggtcaag
gcatacctgaaagaaggcaactgggaaggcgcgatcgattcgcgtggcgcttctttccgc
gaaatgatcacgattttcgaagccatgtcctcccccaccacaaacactacgggctgctgc
gatggcggttcgccgcgcgtgggtatcatccacgcgggcggcctggcgccgggcatgaat
cctgcggcgcgcgcagccgtgaagctgggtattgatcgcggatacacgatgattgggatc
gacggcggtttccctggtttgcttgaaggccacacgcgcgttctcgaatggggcgacgtg
gagggctgggccgaagatggcggcgccgagcttggcacccgccgcacgattcctgacgtg
gatcagtattacgccctatcccgcgcgatcgaaaatgcggaacttgatgcgctcatcgta
atcggcggtttcaagggttacaagatggcttacgatatgggccaggagaaggaccgctat
cctgggtttaatattccgattgtgtgtatcccggcatcgattgacaacaatttgcctggt
tccgagcatgcgattggtgcagatactgcgttgaatacgaacgtggaaacgttggataag
attcgcacgtctgcttctgcatcgcaacggtgtttcgttgcggaaacgatggggcgcaac
acgggctatttggcattgttctctgcgatttcttcgggcgccgaacaggtgtatttggct
gaaacggggatcacgttgccgcaacttgcggaggatacccagcggatgattaacgcgttc
gaacacgggcgtcacctgtatttggtgattcgtaatgaggatgcgtccgaatactacacc
accgatttcttggggcggattttcgaagaagaagggcacaagcttttcgatgttcgcacg
tccgttatcggccacgcccagcagggcgggaacccgtcgcctttcgatcgtacgatggcc
gcacgtatcgtgaattctgcgatcaacgttctcgacgacgaacttcgcactcgcgttaaa
aactcacgttcgttccatattggcatggttgatggggttatccaggctatgccgctttct
cacatgggcgatctgattgatatggaggcgcgcacgcagttcgaaccatggtggttgccg
ttgcgtcacgtggtgaacgtggtgtctgatccaacctacgctggaccgttggaggatctg
gcgatcgtgcagtag

DBGET integrated database retrieval system