KEGG   Arcanobacterium haemolyticum: Arch_1292Help
Entry
Arch_1292         CDS       T01242                                 

Definition
LPXTG-motif cell wall anchor domain-containing protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Arch_1292
  Lipid metabolism
   00600 Sphingolipid metabolism
    Arch_1292
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Arch_1292
Enzymes [BR:ahe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Arch_1292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1428762..1433996)
Genome map
AA seq 1744 aa AA seqDB search
MTSFFAESRSGGSLAKRLVAFTATAGMVMTSHGTALAVDNDQTVRSASSTQMNSIPETVY
TNSYTDAKTRVTSFNENWKFSLGDTPGAKESVFDDSRWTNVNVPHDYSIDQPYTRAGEAE
SAYKPGGVGWYRKTFQLGKDMEGKRIFLNFDGVYMDSTVYVNGTEVAKHPYGYTPFRVDI
TDAAKVGAENTVSVRVNNEIPTSRWYSGSGIGRDVDLIVTDLVHVEGVTVSSTALSASNQ
TKVPTDIKVRVRNSGNAEKHVTVDHTIFPKGKDAKETIGKSTSEHTVKPGELTTIDSSVE
AKNPELWSTTKPTLYTVRTEVKIDGKTVDTYDTDFGYRYFAFDANTGFSLNGQKMKLKGV
SMHHDQGALGSVSTRAALARQVKLLKEMGVNAIRTTHNPSARQLVDICNREGVLLIEEFF
DGWTAPKNQNRNDYSRFFKEKMTTGKLVGSDANKTWAQFDLEQAIARDVNSPAIIMWSIG
NEVTEGTSGVPGYDKTQQNLISWVKAQDSTRPVTQGDNKTKDDKRELNSEAIAKANGVVG
FNYMKGEKYASVHAQHPEWKIYGSETASAVNSRGVYNEIKSLKDAGGQQLTSYDYSAVGW
GHVASEAWFDTITRDFVAGEFVWTGFDYLGEPTPWNGQAPGVAEHATWPAPKNSYFGIID
TAGLPKDTFYFYQSQWNDALHTLHILPAWNEEVVHKDTEGKVPVVVYSDADAVELFFTPE
GETTATSLGKKHFTLKKTDAGYSYKVAKEQGNPTHKDLYFTWNVPFKPGTLTAKAYDSHG
KEIPEKELHGRHSITTAKNATQLKADVDRLKISADGTDLAYVHVKVTDAAGHVVPDARNK
VTFKVEGEGTLVGIDNGSSPDHQSFRDDNRAAHAGELVAIVQSTKTAGNITVTATADGLK
TATTTITSEPVPGKASEKAIDSIRYSRHIYVKAGSKLTMPETVEVRYTDGSKETANVSWN
PLSSEQLAKPGTHTVLGNVNGTDVKLFVNVIDGIAALLNYSTTTPEGSVPTLPDTRPAIL
PDGTISNAFFSVTWDKLTKEMFDKAGTVVVKGTANVFGKDLPVTAHVRVQTEHITIGANV
AGAAMKLEQSVAQDKQSDTLEAVRDGKTEHNPNPDGNTNTSAWSNWKASQDGETTSDITF
AYATQQRFGQAKIHFFQDSASARWPEANTTKIAVSEDGHTWTPVATTETIGAEKNRVKAY
TYSFTPVSATYVKITVTNAEKRTKAVSQRPCTGITEIELNLAQGSFSTFDKAELGSLTVN
GQKVSASALKAKEFSTRALSAVVNAEGADNTAVTVLPAFDNKIKILMESEDNQKQDTFVI
NLATKGTEAPLAASDDSRDYPVENITPKASSEQAINASKNEGPAALAFDGKENTFYHSNW
KTIAPFNTLNMVMELKEPTSIEALRYLPRQNGNNNGTVTSYRVDYSDNGKDWKSAGEGTW
ENPNEKGWRLASFTPVTAKFFRLAPVHTAGDGDQKDKFFSAAEIRLRMPKATINIADTKA
ATVTMPKNVSVDRVDDEHPVLYPQLADAGFKVTVKDSDKVLTYGVDYLLEFANNTKPGTA
TVTIKGIEQYSGVVKHDVEILVKAPTVAGIAISTPPAKTSYTAGETFDPAGMIVTVAMSN
GTEKTVDYGAQTAGDFAFTPALGTPLNVEIKDVTVSYQGKTAVQSIQVTDKAQTPPASDG
PGTSDGSSAPTNNSGDGAKTGAHVSGKKLSKTSLARTGVDVTTLALLGLGIGVAGVALYR
RRNA
NT seq 5235 nt NT seq  +upstreamnt  +downstreamnt
atgacatctttctttgcggaatcccgaagtggaggatcattggccaaacgtcttgtagca
ttcacagctacagcagggatggttatgacatctcatggaacagcgttagctgtggataat
gatcaaactgtgcgttcggcgtcgagcacacaaatgaactcaattccggaaaccgtctac
acaaactcatatacggacgcgaaaaccagagtgaccagcttcaatgagaactggaaattc
agcttaggtgatacgcctggtgcgaaggagtcagttttcgacgattcgcggtggaccaat
gttaatgttccacacgattattctatcgatcagccatacactagagcaggtgaagccgaa
agcgcctacaagcccggaggcgttggctggtatcgcaagactttccagctggggaaggac
atggaaggtaaacgcatcttcctcaacttcgatggcgtgtacatggattccaccgtttac
gtgaacggaaccgaagttgcgaagcatccgtacggatacacgccgttccgcgtggatatt
acggacgccgcgaaagtaggagcggagaatactgtctcggttcgagtgaacaatgagatt
ccaaccagccgttggtattccgggtcgggcattgggcgtgacgtggatttgatcgtcacg
gatctggtacacgtagagggtgtgacggtttcgtcgacggcactatctgcttcaaaccaa
accaaagttccaacagatattaaggtacgtgtgcggaattctggcaacgccgaaaaacac
gtgacagtagaccacacgattttcccgaagggcaaggatgccaaggaaacaattgggaag
agcacgtctgaacacacggttaagccgggcgaacttacgaccatcgattcgtccgtggaa
gcgaagaatccagaattgtggtctaccaccaagccgactctttatacggtacgcaccgaa
gtgaagatcgatgggaagactgtagatacgtacgataccgatttcggttatcgctacttt
gctttcgatgctaatacgggtttctcgctcaacggccagaagatgaagctgaagggcgtt
tcgatgcaccacgatcagggtgcgcttggttcggtttctactcgcgccgcgctcgcgcgc
caggtgaagttgctgaaggagatgggcgttaacgcgattcgcaccacgcacaatccgtcc
gcgcgccagctggttgacatctgtaaccgcgaaggcgtgcttctgatcgaagaatttttt
gacggatggaccgcgcccaagaaccagaatcgtaatgattactcgcgtttctttaaagag
aagatgacgacggggaagctcgttggatcggatgctaataaaacgtgggctcagttcgat
cttgagcaagcgatcgcgcgtgacgtgaactcgccggcgatcatcatgtggtctatcggc
aacgaagtgacggaagggacgtcgggcgttcctggttatgacaagactcagcaaaacctg
atctcatgggtcaaggcccaagattctacacgccctgtaactcaaggcgacaacaagacg
aaggatgataagcgggagttgaactctgaggcaatcgccaaagcgaatggcgttgttggc
tttaactatatgaagggtgaaaagtacgcgagtgttcacgctcagcacccagagtggaag
atttacggatctgaaacggcatccgctgttaatagccgtggtgtttacaatgaaattaag
tcattgaaagatgctggcggtcagcagttaacatcgtacgactattcggcagtgggctgg
ggacatgttgcttcagaggcctggttcgatacgatcacccgtgattttgtggccggcgaa
tttgtgtggactggtttcgattatttgggcgaaccaactccatggaatggacaagcacct
ggagttgcggaacatgcaacctggcctgcgccaaagaactcctacttcggcatcattgat
acggccggattgcccaaggatacgttctatttctaccaaagtcagtggaacgatgctctc
cacacccttcacatcctgccagcatggaatgaagaggtagtccacaaggataccgaaggc
aaggtgcccgtggttgtctattcagatgctgatgcggttgaattattcttcactcctgaa
ggcgaaacaacagctacgtcactaggtaagaagcactttacactcaagaagactgacgca
ggctacagttacaaggtagctaaagaacaaggcaaccccacgcacaaggatttgtatttc
acgtggaacgttccattcaagccaggcacgttaacagcgaaagcttacgattctcatggg
aaggaaataccggaaaaggaattacacggccgccactcgatcacgacggcgaagaacgca
actcagctcaaggctgatgtagatcgtttaaagatctccgctgatggcacagatctggca
tacgttcacgtgaaggtaacagacgcagctggacatgttgtgccagatgcacggaataag
gtgacgttcaaggttgaaggcgaaggcacactcgttggtattgataacggtagctcgcct
gatcaccagtcgttccgcgacgataaccgtgcggctcatgccggcgaactagtggctatc
gtccagtctacaaagaccgcaggtaatatcaccgttacggcaactgcagacggacttaaa
acagcaaccaccacgatcacttccgaacctgtacccggcaaggcttctgagaaagcaatc
gatagtattcggtattcacggcacatctacgtgaaggctggatcaaagctcacaatgcca
gaaactgttgaagtgcggtatacggatggaagtaaagaaactgctaacgtctcctggaac
ccattgagctctgaacagttggcaaagcctggtacacacaccgttctaggaaacgtcaat
ggaaccgacgtgaaactcttcgtcaatgtgattgatggaattgctgcgctcttgaactac
tccacaactactccagaaggttcagttccaacgttgccggatacgcgcccggcaatcctt
ccagatggcaccatctcgaacgcattcttctccgttacgtgggacaaactaacaaaggag
atgtttgataaggctggaaccgtcgtcgtcaaaggcaccgcaaacgtcttcggtaaagat
cttccagtcaccgcacatgtacgcgtccaaaccgaacacatcacaatcggcgcgaacgtt
gccggtgcggcgatgaaacttgaacagtctgtggcacaagataagcaatcggatacgctt
gaagcggtccgagacggcaagacggaacacaatccgaatccggatggaaacacaaacaca
agcgcatggtccaactggaaagcatctcaagacggcgaaacaacatctgatataaccttc
gcgtacgcaacgcaacaacgcttcggacaagcgaagatccacttcttccaagactcggct
tcggcacgttggccagaagcaaacacaacgaagatcgcagtttcagaagatgggcacacg
tggactccggtagcaacaactgaaacaatcggtgccgaaaagaaccgagtgaaggcatac
acttactcgttcacgccggtttctgctacgtacgtcaagataacagtgactaatgcagag
aaacgtaccaaggcggtatcacaacgcccatgcaccggcatcaccgaaatcgaactgaac
ttggcgcagggaagtttctcaacgttcgataaggctgaactaggatcattgacggtgaat
gggcaaaaggtatcggcgtctgcgctgaaagccaaggagttttctactcgcgcgctcagc
gccgtggttaacgccgaaggagcagacaacacagccgtgactgttcttccggcgttcgac
aacaagatcaagattctgatggaatcggaagataaccagaagcaagacacgttcgtgatt
aacctggctacgaaggggactgaagctccgcttgctgccagcgacgattcgcgtgattac
ccggtagaaaacatcactccgaaggcctcaagtgaacaggccattaatgctagtaaaaat
gaaggccctgccgcgcttgcgttcgatggaaaagagaacactttctaccattcgaactgg
aagacgattgccccattcaacaccttgaacatggtgatggagttgaaggaaccaacaagc
attgaagctctccgctacctgccacgccagaatggaaacaacaacggtaccgtgacaagc
tatcgtgttgattattctgacaacggcaaagactggaagagcgctggagaaggaacatgg
gaaaacccgaatgagaagggatggcgccttgcctcctttacaccggtaaccgcaaagttc
ttccgccttgccccagtccacacagccggcgatggcgatcagaaggacaagttcttctcc
gctgcagaaatccgtttgcgcatgccaaaagcaacaatcaacatcgcagatacgaaggct
gcaacagtcaccatgccgaagaacgtgagtgttgaccgggttgacgatgaacacccagtt
ctctacccacagttggctgacgccggattcaaggtaacagtgaaagattctgacaaagta
ctgacgtatggcgtggattatctgctggaattcgccaacaacacgaagccaggaacggca
actgtgactatcaaaggtatcgaacaatactcaggtgtagtgaagcatgatgttgagata
ctcgtgaaagctccaacagttgcagggatcgctatctctacaccacctgccaaaacctca
tacacggcgggggagacgttcgatcctgcagggatgatcgttactgttgcgatgagcaac
ggaaccgaaaagactgtggactatggtgcacaaactgccggcgatttcgctttcactcca
gctttaggaacaccgttgaacgttgagataaaagacgtcactgtgagctaccaaggcaaa
acagcagttcagagtattcaggtgacggacaaggcacaaacgccaccagcatcagacggc
cctggaacatctgatggaagctcagctcctacgaacaattcaggggacggagctaaaact
ggggcacacgtatccggaaagaagctaagcaaaacgtcgctcgcacgtaccggcgtggat
gtgacaacgctagcgcttcttgggctgggtattggtgttgcaggcgttgccctgtaccgc
cgccggaatgcctaa

DBGET integrated database retrieval system