KEGG   Arcanobacterium haemolyticum: Arch_1296Help
Entry
Arch_1296         CDS       T01242                                 

Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arch_1296
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Arch_1296
   00640 Propanoate metabolism
    Arch_1296
   00660 C5-Branched dibasic acid metabolism
    Arch_1296
Enzymes [BR:ahe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Arch_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1436615..1437787)
Genome map
AA seq 390 aa AA seqDB search
MDLYEYQARELFAKHGVPVVNGIVATTPEEAEQAARQLLEATNLVVVKAQVKTGGRGKAG
GVKLARTPEEAKERAGDILGMDIKGHTVHRVLIASGADITEEYYFSILLDRSERRYLAMC
SKEGGMEIEQLAVERPEALAKVPVNPNVGITEAVAREILTEAGFAPEEHDAIVPVLCRLW
DVYTQEDATLVEVNPLVKTADGSIIAVDGKVTLDDNARIRHPEHAQFVDKQTENPLEARA
KSLGLNYVKLDGGQVGIIGNGAGLVMSTLDVVAYAGEEYGVGPANFLDIGGGANADVMSH
GLDVILNDPDVRSVFVNVFGGITACDEVAKGIVAALDILGDAASKPIVVRLDGNKVAEGR
AILAEAHHPLVTLEPTMDGAAAKAAQFAGK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggatctctacgagtaccaagcccgcgaacttttcgccaaacacggcgttccagtagta
aatggaatcgtggcaacaacccccgaggaagcggagcaagccgctcgccagctcctagaa
gcaaccaatctcgtcgttgtcaaagctcaagtgaaaactggtggacgcggcaaagcaggc
ggcgtgaaactcgcccgcactccagaagaagctaaagaacgtgccggtgacatcctggga
atggacatcaaggggcacactgttcaccgagtcctcattgccagcggagcagacatcacg
gaagaatactacttctccatcctgcttgatcgttccgaacgccgctaccttgccatgtgt
tccaaagaaggcggcatggaaatcgaacagctcgctgtggaacgtccagaggctttggcg
aaagtgccggtaaacccaaatgtgggaattactgaagcagtagcccgcgaaatccttacc
gaagccgggtttgccccagaagaacacgatgcgatcgtgccagttctgtgccgtctatgg
gatgtttacactcaagaagatgccactcttgttgaagtgaacccgctggtgaaaactgct
gacggcagcatcatcgcggtggacggcaaagtgacgttggatgataacgcccgcatccgc
cacccagagcatgcccagttcgtcgataagcaaacagaaaacccgcttgaagcacgcgcg
aagtcgcttggcctgaactatgtgaaactcgatggcggccaagtgggcatcatcggaaac
ggcgccggacttgttatgtccacactggacgtggtggcatacgctggcgaagaatacggt
gttggcccagcaaacttccttgacattggcggcggtgcaaacgccgacgtcatgtcccac
ggcctcgatgtgatcctcaacgatccagatgttcgctccgtatttgtgaacgtatttggc
ggaattacagcttgtgacgaagttgcaaagggcatcgtggcagcactcgatatcctcggt
gatgcggccagcaagccaatcgtggttcgcctagacggcaacaaggtggccgaaggccgc
gcgatcctggcagaagcacaccatccactcgtcacccttgaaccaacaatggacggggca
gcagccaaggccgcccagttcgccggaaagtga

DBGET integrated database retrieval system