KEGG   Arcanobacterium haemolyticum: Arch_1476Help
Entry
Arch_1476         CDS       T01242                                 

Definition
ribose 5-phosphate isomerase
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:ahe01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ahe01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ahe00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ahe00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1623077..1623526)
Genome map
AA seq 149 aa AA seqDB search
MGFRVVVASDNAGAEYRHFIKEDLQADPRVDEVIDVGVESTDGTYYPHVSAAGAKIIADG
KADRGVFICGTGMGMAIAANKIHGIRAAVAHDSFSVERLVLSNNGQVLCLGERVIGKELA
RRLVKEFLDYEFDASSASKPKVDAICSYE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
gtgggttttcgagttgtagtagcatccgataatgcgggtgcagaatatcgtcattttatc
aaggaagatttacaggcggatccgagagttgacgaagtgattgacgttggggttgaatct
acggatggtacgtactatccgcacgtttctgcggctggtgccaagataatcgctgatggt
aaagctgaccgaggggtgttcatttgcggtactggtatgggaatggctatcgcggcgaac
aagattcatggtattcgggctgcagttgctcatgattcattttctgtagaacgattagtg
ctttccaataatggtcaagtgttgtgtttgggcgaacgagttattgggaaagagctagct
cggcgattagtgaaggaatttcttgattatgagtttgatgcgtcatcagcgtctaaacca
aaagtagacgcgatctgttcttatgaataa

DBGET integrated database retrieval system