KEGG   Arcanobacterium haemolyticum: Arch_1645Help
Entry
Arch_1645         CDS       T01242                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Arch_1645
DNA repair and recombination proteins [BR:ahe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Arch_1645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1782379..1783005)
Genome map
AA seq 208 aa AA seqDB search
MAGVYDGAVQSLIDELGRLPGVGPKSAQRIAFHLLEADDDEVNHLVEALQAVKAKVQFCT
VCGNIAEGDLCRICADLRRVESTICVVEEAKDIVAIERSREYRGKYHVLGGAIDPIGGVG
PDNLRIRELYARLQDGTVEEVILAMDPNVEGEATATYLAINLAHMGVVVSRLASGLPVGG
DLEYADEVTISRALEGRQRIHTPSTPAL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagtctacgacggcgccgttcaaagcctcatcgacgaactcgggcggctaccc
ggtgtggggcccaaaagcgcccagcgcatcgcgttccatcttctagaagcagacgacgac
gaagtaaaccaccttgttgaagccctccaagcagtgaaagcaaaagtgcaattctgtacc
gtgtgcggaaatattgccgaaggagatctgtgccgaatctgtgctgacctgcggcgcgta
gaatctaccatctgcgtggttgaagaagccaaagacatcgtggctatcgaacggtcccgc
gaatatcgcggaaaataccacgttcttggcggtgccatcgatccgatcggcggtgttggg
ccagataatcttcgcatccgtgaactttatgcccgattgcaagatgggacagtggaagaa
gtcatcctagccatggatcccaacgtagaaggcgaagccaccgcaacttacctggcaatc
aaccttgcacacatgggagttgtagtatcacggctagcctccgggctgccggtgggtggc
gatcttgaatacgcagatgaagtaacaatttcgcgggcgcttgaaggccggcaacggatt
cacacgccaagtacgccggcgttgtga

DBGET integrated database retrieval system