KEGG   Arcanobacterium haemolyticum: Arch_1667Help
Entry
Arch_1667         CDS       T01242                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arch_1667
   01230 Biosynthesis of amino acids
    Arch_1667
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Arch_1667
  Energy metabolism
   00680 Methane metabolism
    Arch_1667
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arch_1667
Enzymes [BR:ahe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Arch_1667
Exosome [BR:ahe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Arch_1667
  Exosomal proteins of melanoma cells
   Arch_1667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1803542..1804282)
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLVRHGESEWNAKNLFTGWVDVPLSEKGTEEAKRAGKMLKDADVLPDLLFTSLLR
RAIMTANLSLDAADRHWIPVKRNWRLNERHYGALQGKNKKEIRDEYGEDLFMEWRRSYDV
PPPAIEAGSEFSQDSDPRYAGEPIPATECLKDVLERLLPFWEGEIVPELKSGKTVMIAAH
GNSLRAIVKHLDEISDDEISGLNIPTAIPLFYELDEETLKPITKGGTYLDPEAAKAAIEA
VANQGK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaaactcgttctcgtccgtcacggcgaaagtgaatggaacgcaaagaacctc
ttcaccggttgggtagatgtcccactttccgaaaagggaactgaagaagctaagcgtgcg
ggtaagatgctcaaggatgccgatgtgcttcctgatctgctcttcacctccctcctacgc
cgtgcaatcatgacagccaacctttcccttgatgctgccgatcgccactggattccagtg
aagcgcaactggcgcctcaacgagcgccactacggtgcgctccagggtaagaacaaaaag
gaaattcgtgacgaatacggtgaggacctcttcatggagtggcgccgttcgtacgatgtt
ccaccaccggcaatcgaagcaggatccgaattctcccaagattccgatccgcgttacgca
ggtgaaccaatcccagcaactgaatgcttgaaggacgtgctcgaacgcctcctcccattc
tgggaaggcgaaatcgttccagaactcaagtcgggtaagactgtcatgatcgccgcacac
ggtaactccctgcgcgcaatcgtcaagcacctcgatgagatctctgacgatgagatttcc
ggtttgaacattccaaccgcaatcccactcttctacgaattggatgaagaaacccttaag
ccaatcaccaagggcggcacctacctcgatccagaagccgcaaaggctgcaatcgaagca
gttgctaaccagggcaagtga

DBGET integrated database retrieval system