KEGG   Arcanobacterium haemolyticum: Arch_1729Help
Entry
Arch_1729         CDS       T01242                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
ahe  Arcanobacterium haemolyticum
Pathway
ahe00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ahe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Arch_1729
Enzymes [BR:ahe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Arch_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ADH93411
JGI: Arch_1729
UniProt: D7BL81
Position
complement(1869237..1870139)
Genome map
AA seq 300 aa AA seqDB search
MDIAVIGSNMVDLISYIDRMPAEGETLEAPDFKMGCGGKGANQAVAAARLGANVLMVTRV
GNDIFADNTVANFAKNGIDTRYVLRTEMSSGVAPIFVDAESHNSILIIKGANSMLSTADI
DAAAADIAQCKLIVLQLEVPLETVYAAIRFGKEHDIPVLLNPAPAQPDLVLSEVKDCSYF
MPNESELSLLTGMPVDTIDDVRNAASALLDAGMKNVIVTLGSRGVLWMAEGVDELLPACE
VSARDTTGAGDAFIGCFSHYLVQTGDVREALTKANRYAADSVTKLGTQTSYATAEEFAQL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggacatcgcagtaatcggatcaaacatggtagatctgatctcctacatcgatcggatg
ccagcagaaggcgaaaccctggaagctcccgatttcaaaatgggatgcggcggcaagggt
gccaaccaggccgtggcggccgcgcgtttgggcgcgaacgtgctgatggtaacccgcgtg
gggaacgacattttcgcagacaacaccgtggcgaactttgccaagaacgggattgatacg
cggtacgttctgcggactgagatgagctccggtgtggcgccgatcttcgtggatgccgaa
tcgcacaactcgatcctgattattaagggggcaaactcgatgctgagcacggccgatatc
gatgcggctgccgccgatatcgcccagtgcaagctgatcgtgctgcagctggaagtgcca
ctggaaaccgtgtatgccgcgattcgattcggcaaggaacacgatattccagtgctgctc
aacccggctccagcccagcctgacctggtgctttccgaagtgaaagactgctcctacttc
atgccaaacgaatccgaactctcgctgctcaccggcatgccagtggacacgattgatgac
gtgcgcaatgcggcttccgcgctgctggatgcgggcatgaagaacgtgatcgtgacgttg
ggctcacgtggggttttgtggatggcggaaggtgtagacgaactcctgccagcgtgcgaa
gtgagcgcacgcgacaccaccggagctggcgatgccttcatcgggtgcttcagccactac
ttggttcaaaccggggatgtgcgcgaggccctgaccaaggccaaccggtatgctgcggat
tctgtgaccaagctcggtacacagacgtcgtatgcgactgcggaggaatttgcgcagctg
tga

DBGET integrated database retrieval system