KEGG   Aeromonas hydrophila AL06-06: RY45_12125Help
Entry
RY45_12125        CDS       T03748                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ahh  Aeromonas hydrophila AL06-06
Pathway
ahh00071  Fatty acid degradation
ahh00072  Synthesis and degradation of ketone bodies
ahh00280  Valine, leucine and isoleucine degradation
ahh00310  Lysine degradation
ahh00362  Benzoate degradation
ahh00380  Tryptophan metabolism
ahh00620  Pyruvate metabolism
ahh00630  Glyoxylate and dicarboxylate metabolism
ahh00640  Propanoate metabolism
ahh00650  Butanoate metabolism
ahh00900  Terpenoid backbone biosynthesis
ahh01100  Metabolic pathways
ahh01110  Biosynthesis of secondary metabolites
ahh01120  Microbial metabolism in diverse environments
ahh01130  Biosynthesis of antibiotics
ahh01200  Carbon metabolism
ahh01212  Fatty acid metabolism
ahh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RY45_12125
   00630 Glyoxylate and dicarboxylate metabolism
    RY45_12125
   00640 Propanoate metabolism
    RY45_12125
   00650 Butanoate metabolism
    RY45_12125
  Lipid metabolism
   00071 Fatty acid degradation
    RY45_12125
   00072 Synthesis and degradation of ketone bodies
    RY45_12125
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RY45_12125
   00310 Lysine degradation
    RY45_12125
   00380 Tryptophan metabolism
    RY45_12125
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RY45_12125
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RY45_12125
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RY45_12125
Enzymes [BR:ahh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RY45_12125
Exosome [BR:ahh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RY45_12125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJQ54794
Position
complement(2664592..2665755)
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALANLTAPELGACAIAAAMAEAGLRGEQIDEAYLGNVLSAGV
GQAPARQAVLKAGLPDSIPCTTVNKVCGSGMKAVMLAADGLRLGDTNVVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLTRADMDAFAIA
SLERALAAQRSGAFAAELAPVMAGDTLLLAEDEQPAKARPEKIPQLKPAFSKTGTITAAN
ASSISDGAAALILMRSDTAVQLGLPVLARLVGYQSHAALPAEFTSAPVGAIKGLLAKVGW
RVEEVDLFEVNEAFAMVSLLAMAGCQLPHDKVNVNGGACALGHPLGASGARILVTLIHAL
RERGLTRGVASLCIGGGEATAVAIELG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtgattgttgcggccaaacgtacccccatgggggccttccagggggccctg
gccaacctgacggcacccgaactgggcgcttgtgccattgccgcggccatggcagaagcg
gggctcaggggagagcagatcgatgaagcctatctgggcaacgtgctgagtgccggggtc
ggccaggcccccgcccgccaggcggtgctgaaggcgggcctgccggacagcatcccctgc
accacggtcaacaaggtgtgcggttccggcatgaaggcggtgatgctggcggccgatggc
ttgcgactcggcgatacgaacgtggtgatcgccggcgggatggagagcatgagccgcgcc
ccctatctgctcgacaaggcgcgcagcggttttcggatggggcaccagagcgtgctcgat
cacatgtttctcgacgggctgcaggatgcctacgaagggcagctgatgggacattatgcc
cagctgagcgccgatcgcgccggactgacccgtgccgacatggatgcctttgccatcgca
tcgctggagcgggcgctggcggcccagcgcagcggtgcctttgcggcggagctggcgccg
gtgatggccggagataccctgctgctggccgaggatgagcagcctgccaaggccaggccc
gagaagatcccccagctcaagccggccttcagcaagacgggcaccatcacggcggccaat
gccagctccatctcggacggggcggcggcgctgatcctgatgcgctccgacactgccgtg
cagctggggctgccggtgctggcgcgactggtgggttatcagagccacgcggccctgccc
gccgagtttaccagcgcaccggtaggggccatcaaggggctgctggccaaggtgggttgg
cgggtggaggaggtggacttgttcgaggtcaacgaggcgtttgccatggtcagcctgctg
gcgatggccggttgccagctgccccatgacaaggtcaacgtgaacggcggcgcctgcgcg
ctgggtcatccgctgggggcgagtggtgccaggatcctggtgaccctgatccatgccctg
cgcgaacgcggtctcacacgcggggtggccagtctgtgtatcggcggcggggaggcgacg
gcggtcgccatcgagctgggttag

DBGET integrated database retrieval system