KEGG   Acidianus hospitalis: Ahos_0166Help
Entry
Ahos_0166         CDS       T01493                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aho  Acidianus hospitalis
Pathway
aho00300  Lysine biosynthesis
aho01100  Metabolic pathways
aho01120  Microbial metabolism in diverse environments
aho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ahos_0166
Enzymes [BR:aho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ahos_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AEE93059
UniProt: F4B4H0
Position
166817..167467
Genome map
AA seq 216 aa AA seqDB search
MLIELTKKLISFKTYNDNELHECALFIKDYLENQGFKAEIKEYVKGYPVVISSSGKGKPL
MLNGHFDVVPPGEGWSSDPFVPKVVDDKIYGRGATDMKAGLAVLMETYVLMADKLDYPLL
FTAVSDEETGGKRGSKFLAEEFSPFFVIIGEPTGSERINIGEKGLLQIKIKERGKSAHGS
TPSLGDNSILKLIDDILILEKEINDFSVSIPRKNKS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctaatagaactgacgaagaaactaatttctttcaagacttataatgacaacgagctt
cacgagtgcgcattatttataaaggattatttggaaaaccaaggttttaaggcagaaatt
aaggaatacgttaaagggtaccctgtagtaatttcctcaagcggaaaaggaaaaccctta
atgcttaatggacatttcgacgttgtaccgcctggagaaggttggtcttcagatcctttc
gttcctaaggtggtagacgataaaatttacggaagaggggcgacagatatgaaggcagga
ttagcagttctcatggagacttacgtattaatggcagataagttagattatcctttactt
tttacagcagtctcagacgaggaaactgggggcaaaagaggaagtaaattcttagccgag
gagttttctcctttctttgtaataataggtgagcctactggttcagaaagaataaacata
ggagaaaagggcttattgcaaataaaaataaaggaaaggggtaaatcagctcatggaagt
actccttccctcggtgataattctattttgaagctgatagacgatattctaattttagag
aaagagataaatgatttttccgtcagtattcctagaaaaaataagagttaa

DBGET integrated database retrieval system