KEGG   Acidianus hospitalis: Ahos_0196Help
Entry
Ahos_0196         CDS       T01493                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
aho  Acidianus hospitalis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ahos_0196
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ahos_0196
Enzymes [BR:aho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ahos_0196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
198297..199511
Genome map
AA seq 404 aa AA seqDB search
MESLYKEIDNQRDFIISLYKEFIPIKALGPENGGEGEYSRAIKLKEIMEKYFDEVKEIDV
KDERVPSKVRPNLIGTIKGRNQSKTLWIIAHMDTVPEGDRSLWKFDPFSITVDGDYIYGR
GVEDDGQAIVLGITLAKVLKELNLTPNINFSLLISADEETGSKYGVSYLAKNYSLFNKDD
IILIPDAGNPEGSMIEVAEKSILWLKFTVIGKQAHASTPEKGINAHLLSMILGVTLYEEL
HEKYDAKNELFEPPTSTFEITKVEKNVENVNTIPGKHTFYMDCRILPQYDVDDVLNTINE
IVKRFEAENNCKVEVEVVNREDTTRPTDENSETVKLLKNAIKAVKGIDAKAIGIGGGTYA
KYLRSLGLNPVVWMTCDETAHEPNEYVRISYILSDLKVISYMLM
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttggaaagtttatataaagagatcgataatcagagagattttattatttctctatataag
gaattcattcctataaaagcattaggtccggaaaacggcggtgaaggagaatattctaga
gctataaaattaaaggaaattatggaaaaatactttgacgaagttaaggagatagacgta
aaagatgaaagagttccttcaaaagtaagacctaaccttatcgggacaataaaaggaaga
aatcaaagtaagactttatggattatagctcacatggataccgtccctgaaggagatagg
agcttatggaaatttgatccattcagcattaccgtcgacggagattatatttacggtagg
ggggttgaggatgatggacaagcaattgtattaggaattacgctagctaaagttcttaag
gaattaaatctcactcctaacattaatttttccttgctaatttcagcagatgaggagacc
ggaagtaagtacggagtttcatacttggctaaaaattattccttatttaacaaggatgat
ataatattaattccggacgcaggcaatccggaaggatcaatgattgaagttgcagaaaaa
agtattttgtggttgaaatttacagtaataggcaaacaagctcacgcaagcactccagag
aaagggataaacgctcaccttctttcaatgatattaggcgttactctttatgaagaactt
cacgaaaaatatgatgcgaaaaatgaactatttgaaccgcctacttcaacatttgaaata
actaaagttgagaagaacgtagaaaacgtaaatactataccgggaaagcatacattttac
atggactgtagaattcttcctcaatacgacgttgatgacgttttgaatacaataaatgaa
attgtaaaaagatttgaggcagaaaataattgtaaggttgaagttgaggtagttaataga
gaagatactacaagacctactgacgagaattcggagaccgtaaagttgttaaagaatgca
ataaaggcagtaaaaggtattgatgctaaggcaataggcataggagggggtacttacgca
aaatatctaaggtcccttggattgaatcccgtagtttggatgacttgtgatgaaactgca
catgaaccaaacgagtatgtgaggattagttacatactttcggatctaaaagtaatatct
tatatgctaatgtga

DBGET integrated database retrieval system