KEGG   Acidianus hospitalis: Ahos_0267Help
Entry
Ahos_0267         CDS       T01493                                 

Definition
protein-L-isoaspartate carboxylmethyltransferase, Pcm
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aho  Acidianus hospitalis
Brite
Enzymes [BR:aho01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Ahos_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
260745..261443
Genome map
AA seq 232 aa AA seqDB search
MTEKEEILRKIKNPELAEAFKKVDRAKFLPENLRSYAYTHVDEALPILPGINTTALSLGI
YMLDELDLHKGQKVLEIGTGIGYYTALIAEIVDKVVSIEINDEMYKYSSRLLSEYQNVKL
VLGDGTLGHEEEKPFDRVIAWASAPTLLCKPYEQLREGGIMILPIGVGRVQKLYKVVKKG
YTPALENLGEVLFSRIRGLFGFYDDYEDDVESRLSRLERQVKSILSRLEKKV
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaggaggaaattcttaggaagattaagaacccagagctagccgaagcgttc
aagaaggttgatagagcaaagttcctgccggagaatctaaggagttacgcctacactcac
gtcgacgaagctttacctattttacccggaataaatactactgcgttaagtctaggaatt
tacatgcttgatgaattagacttgcacaaaggtcaaaaggttttagaaataggaacagga
ataggctattatactgcattaattgcggaaattgttgacaaggttgttagtatagaaatt
aacgatgaaatgtataaatactcttctagattactttccgagtaccaaaacgtgaagcta
gtgctaggagacggaacgttaggacatgaagaagagaagccctttgatagagtgatagct
tgggcctccgcacctactctcttgtgcaaaccttacgaacagcttagagaaggaggaata
atgattttgcctataggtgtagggagggtacaaaaactttacaaggtagtcaagaaaggt
tacactcctgctctcgaaaatcttggagaagttctattttcaagaattagagggcttttt
ggcttttatgacgattatgaggacgacgtggagagcaggctcagtaggttggaaaggcaa
gtgaagtcaatactaagtaggttggaaaagaaagtttaa

DBGET integrated database retrieval system