KEGG   Acidianus hospitalis: Ahos_0595Help
Entry
Ahos_0595         CDS       T01493                                 

Definition
phosphoglucomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
aho  Acidianus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ahos_0595
   00030 Pentose phosphate pathway
    Ahos_0595
   00051 Fructose and mannose metabolism
    Ahos_0595
   00052 Galactose metabolism
    Ahos_0595
   00500 Starch and sucrose metabolism
    Ahos_0595
   00520 Amino sugar and nucleotide sugar metabolism
    Ahos_0595
  Nucleotide metabolism
   00230 Purine metabolism
    Ahos_0595
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Ahos_0595
Enzymes [BR:aho01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Ahos_0595
    5.4.2.8  phosphomannomutase
     Ahos_0595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
567863..569227
Genome map
AA seq 454 aa AA seqDB search
MGKLFGTDGVRGTINKELTIELAQKLGQAIGTFFGKGSTILIGRDARAGGDMYTRAVESG
LLSAGVKVYEGGFAPTPALQYAVKTLGYDAGVIITASHNPAEYNGIKVIDKDGVEISRDK
ENEIEDIYFSGKFYSEDWKALTYDVKKEDRVIDNYVKGILSHVDVEKIRKKNFKVLIDGA
NSVGSITSPIVARELGCKIYGINTNLDPLFPARTPEPTFDSLKDTAEIAKGLKVDLGVAH
DGDADRAIFIDSQGRVQWGDRSGALLSYWASTKESSFPRRIFTAVSSSVLVQDYLKKYNI
EVVWTKVGSVDIAHKLMEEKGIAGFEENGGFIFPLHQYVRDGAMSFALMLEMLASVNISS
AELFDTLPKYYTVKTKVYINKNTDVEKIYETVKSTYSHGNIITIDGVKIITPDYWFLVRK
SGTEPIIRVMVEAKDKEKAENLANELVKLVGSLV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacttttcggaacagacggagtgagaggtactataaataaagagctaacaata
gaattagctcaaaagctagggcaagctattggaacgttctttggtaaaggatcaacgata
ctgattggaagagatgctagagctggtggagatatgtatactagagccgtggagagcggt
ttattaagtgctggagttaaggtttatgaaggaggcttcgcacctactcctgccttacaa
tatgctgtaaagactttaggttatgatgctggagtaattattactgctagtcataaccct
gcggaatataacggaataaaagtgatagataaggatggcgttgagatttctagagataag
gagaacgagattgaggatatttatttttccggaaagttttattccgaggactggaaggct
ttaacttacgacgtaaaaaaggaggatagagttatagataattacgttaaaggtatttta
agtcatgttgacgtagagaaaataaggaagaagaactttaaagtattgatcgatggtgct
aatagcgtaggttctataacttcacctattgttgccagggagttaggttgtaaaatatat
ggtataaatactaacttagatcctttattccctgcaaggactccggaacccacttttgac
agcctaaaggatactgcggagattgctaaagggcttaaagttgatttaggtgtagctcac
gatggtgatgcagacagagcaatatttatagattcgcagggaagagtgcagtggggcgat
aggagcggtgcattattatcttattgggcttcaacaaaggaaagtagctttcctagaaga
atatttaccgcagtctccagttctgtcctagttcaagattaccttaagaaatacaatata
gaggttgtttggactaaagttggtagtgttgatattgctcataaattaatggaagagaag
ggaattgctggctttgaggaaaacggaggcttcattttccctcttcatcagtatgttaga
gatggcgcaatgtcttttgctttaatgcttgaaatgcttgcatctgtaaatatctcttct
gcagaactttttgatacattaccaaagtattatacagtaaaaactaaggtttacataaat
aaaaacacggacgttgagaaaatatacgaaacagtaaagtctacatactctcatggtaat
atcataactatagatggtgtgaagataattacaccggactattggttcttagttagaaag
agtggtactgagcctataataagggtaatggttgaggctaaagataaggaaaaagcagaa
aatcttgcaaatgagttagtaaagctggtaggtagtttagtatga

DBGET integrated database retrieval system