KEGG   Acidianus hospitalis: Ahos_0619Help
Entry
Ahos_0619         CDS       T01493                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aho  Acidianus hospitalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ahos_0619
Enzymes [BR:aho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ahos_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(590174..590836)
Genome map
AA seq 220 aa AA seqDB search
MRILFLRPEGSNIPKVDFAEVINIPIFSPICIDYPSLPLTEAYAFTSSNAVKCFHDFDKI
KGKQIFSIGKSTAKELMAHGINSLYPPNYDSLDLAEFIKSKGIKSLTAIRSKKASNDLKN
SLQNIEYHEIYDYDTIINKEELEKSKDYLENCKIDVVVLTSSEIAKAVASSLKNCYKIVS
IGPMTTKTILSLRPDLKIFQSKIYDIEGVIDLIKREVKFQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcttattccttaggccagaaggtagcaatatacctaaagttgattttgcggaa
gttataaatataccaatctttagtcctatttgtattgattacccctctttgcctttaaca
gaagcttatgcttttacaagttctaatgcagtaaagtgctttcatgattttgataaaata
aaaggaaaacaaatcttctctataggtaaaagtactgcgaaagagctgatggctcatggg
attaattctctttatcctccaaattatgatagtctagacttagcggagttcattaaaagt
aaaggaataaaatcattaactgccataagaagtaagaaggcttctaatgatctaaagaat
tcgcttcagaatattgaatatcacgaaatttatgattatgatactattatcaataaggaa
gaactagaaaaaagtaaagattatctggaaaattgtaagatcgacgtggtagtactgact
agctctgaaatagcaaaggctgtagcgagttctcttaagaattgctataaaatagttagt
ataggccctatgactactaagactattttgtctctaagaccagacctaaaaatttttcaa
agtaaaatatatgatatagaaggcgtaattgacttaatcaaaagggaagtgaagtttcaa
tga

DBGET integrated database retrieval system