KEGG   Acidianus hospitalis: Ahos_0619Help
Entry
Ahos_0619         CDS       T01493                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aho  Acidianus hospitalis
Pathway
aho00860  Porphyrin and chlorophyll metabolism
aho01100  Metabolic pathways
aho01110  Biosynthesis of secondary metabolites
aho01120  Microbial metabolism in diverse environments
Module
aho_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ahos_0619
Enzymes [BR:aho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ahos_0619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 DNA_pol_lambd_f
Motif
Other DBs
NCBI-ProteinID: AEE93507
UniProt: F4B724
Position
complement(590174..590836)
Genome map
AA seq 220 aa AA seqDB search
MRILFLRPEGSNIPKVDFAEVINIPIFSPICIDYPSLPLTEAYAFTSSNAVKCFHDFDKI
KGKQIFSIGKSTAKELMAHGINSLYPPNYDSLDLAEFIKSKGIKSLTAIRSKKASNDLKN
SLQNIEYHEIYDYDTIINKEELEKSKDYLENCKIDVVVLTSSEIAKAVASSLKNCYKIVS
IGPMTTKTILSLRPDLKIFQSKIYDIEGVIDLIKREVKFQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcttattccttaggccagaaggtagcaatatacctaaagttgattttgcggaa
gttataaatataccaatctttagtcctatttgtattgattacccctctttgcctttaaca
gaagcttatgcttttacaagttctaatgcagtaaagtgctttcatgattttgataaaata
aaaggaaaacaaatcttctctataggtaaaagtactgcgaaagagctgatggctcatggg
attaattctctttatcctccaaattatgatagtctagacttagcggagttcattaaaagt
aaaggaataaaatcattaactgccataagaagtaagaaggcttctaatgatctaaagaat
tcgcttcagaatattgaatatcacgaaatttatgattatgatactattatcaataaggaa
gaactagaaaaaagtaaagattatctggaaaattgtaagatcgacgtggtagtactgact
agctctgaaatagcaaaggctgtagcgagttctcttaagaattgctataaaatagttagt
ataggccctatgactactaagactattttgtctctaagaccagacctaaaaatttttcaa
agtaaaatatatgatatagaaggcgtaattgacttaatcaaaagggaagtgaagtttcaa
tga

DBGET integrated database retrieval system