KEGG   Acidianus hospitalis: Ahos_0622Help
Entry
Ahos_0622         CDS       T01493                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aho  Acidianus hospitalis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ahos_0622
Enzymes [BR:aho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Ahos_0622
Exosome [BR:aho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ahos_0622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(592939..593892)
Genome map
AA seq 317 aa AA seqDB search
MIAETNLTEKNLILPIFIKEGILEEEEIKSMPGVFRYPPNDKLIKFVESSYDNGIRNVIL
FGIPKYKDDIASSAYDKNGVIQASVRLLKDTFGDKLIVITDECTDEYTSHGHCGIVKYNS
KGEYFVDNDESLKIHAKIALSQAEAGADIIAPSSMMDGVVGAIRKALDENGYTDTLIMSY
SVKYASTFYSPFRDAAYSKPAFGDRKSYQMDPRNAYEALKEAKLDIEEGADILMVKPAHT
YLDVIRLVKDNFPDYPLAAYHVSGEYSMIKAAALNGWIDERIAVLEITTAIRRAGADLIL
TYYANDIAKWLKEGLPF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatagcagaaaccaatctaactgaaaaaaatctaattttaccaatttttatcaaggaa
ggcattttagaagaagaagaaataaagagcatgccaggagtatttcgctatcctcctaat
gataaattaataaaattcgtagaaagcagttatgataatggaataaggaatgttatactc
tttggaattccaaaatataaggatgatattgcttcctcagcttacgataaaaatggagta
atacaggcaagcgttagactacttaaagatacttttggagataaactaattgtaataaca
gatgagtgtacagacgaatatacttctcatggccattgcggaatagtaaagtacaatagt
aaaggagaatattttgtcgataatgacgaaagtttaaagatacatgctaaaatagctctt
tctcaagcagaagctggtgcagatattatagctccgtcaagtatgatggacggagttgta
ggagctattaggaaggctctggatgaaaatggttatacagatacgctaataatgtcatat
agcgtaaaatatgcttcaacattctattctccatttagagatgccgcatattcaaaacca
gcatttggcgatagaaaatcatatcaaatggatcctagaaacgcatatgaagcattaaag
gaagctaagctcgacatagaagaaggcgcagatatattaatggtaaagcctgcacacact
tatttagacgtaataagattagtcaaagataatttccctgactatccattagcagcatat
catgttagtggtgagtattcaatgattaaagctgcagcattaaatggatggatagatgaa
aggattgcagtattagaaataactacggcaataagaagagccggagctgatttaatactt
acatattacgctaacgacattgcaaagtggcttaaggaggggttaccattttga

DBGET integrated database retrieval system