KEGG   Acidianus hospitalis: Ahos_0900Help
Entry
Ahos_0900         CDS       T01493                                 

Definition
triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aho  Acidianus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ahos_0900
   01230 Biosynthesis of amino acids
    Ahos_0900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ahos_0900
   00051 Fructose and mannose metabolism
    Ahos_0900
   00562 Inositol phosphate metabolism
    Ahos_0900
Enzymes [BR:aho01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ahos_0900
Exosome [BR:aho04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ahos_0900
  Exosomal proteins of bladder cancer cells
   Ahos_0900
  Exosomal proteins of melanoma cells
   Ahos_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
820850..821548
Genome map
AA seq 232 aa AA seqDB search
MKKPIILINFKAYENSFGKKGVDIAKRIEKISIEYSTEVILSVPATMIPILSQEVSLPIY
AQHVDSYPLGAHTGSLLPEMIKEAGAKGTLLNHSEKRIRADEIHDALLRLNKLGLESVVC
VDRYELVEPMAILRPTAILIEPPELIGSGISVSKAKPEVITNAVKEISKVPGVFLIAGAG
ISNGEDVYTAVKLGADGIGVASAVMKAKEPEKVVEDFIKSGIKAMDERNDRN
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagccaataatattaataaatttcaaggcttacgaaaactcatttggtaaaaaa
ggagtagacatcgcaaaaagaatagagaaaatatccatagagtattctactgaagttatt
ttatccgttccggctaccatgatacccattctttctcaggaggtatcattacctatttat
gcacaacacgttgattcttatcctttaggtgcgcatactggatctttattaccagaaatg
ataaaagaagctggggcaaaaggaacattattaaatcatagcgagaaaaggataagagcc
gatgagattcatgacgcattacttagattaaataaattaggtttagaatcagttgtttgt
gtagacagatatgaacttgtagagccaatggccatattaagaccaacagcgatcttaata
gaaccgccggagttaataggctctgggatttctgtatcaaaagctaagccggaagtaata
actaatgccgttaaagagatttctaaagtccctggagtatttctaatagcaggagcgggg
ataagtaatggagaagacgtttacactgctgtaaaattaggagccgatggaataggtgtt
gctagcgcagtaatgaaagctaaggaaccagaaaaggtagtagaagatttcataaaaagt
ggaataaaagcaatggatgagagaaatgatagaaattag

DBGET integrated database retrieval system