KEGG   Acidianus hospitalis: Ahos_1005Help
Entry
Ahos_1005         CDS       T01493                                 

Definition
(RefSeq) acetate-CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
aho  Acidianus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ahos_1005
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ahos_1005
   00620 Pyruvate metabolism
    Ahos_1005
   00640 Propanoate metabolism
    Ahos_1005
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ahos_1005
   00680 Methane metabolism
    Ahos_1005
Enzymes [BR:aho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ahos_1005
Lipid biosynthesis proteins [BR:aho01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ahos_1005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
905459..907399
Genome map
AA seq 646 aa AA seqDB search
MSENLPFEERYYQPPYKQLYKQSLEEPEKFWREMAEGLEWFSPFDKVLDESNAPFYRWFV
GGKINITYNALDRQVKVRRNKIAIYWENEKGESRQLTYGELYNEVNRFAKILQDLGIKKG
DRVLIYLPLMPELPIAMLACARIGAVHSVVFSGFSTQAVIDRINDAKAKLVITTSHTMRR
GKRVELKRIIDEAVSQTPSVEKVLVIKRDEEIELNEERDVLYQDLIKRTGYKKVEPEETL
STDPLFILYTSGTTGKPKGILHLHGGYGLWTYLTTQWVFDLRDTDVFFNTADIGWITGHS
YIVYGPLQNGASVLMYEGVPDYPNPDRWWELVEKYGVTVFYTSPTAIRSLMKYGEEWVKK
HDLSTLRILGSVGEPINPEAWRWYFKNVGNSSLPIVDTWWQTETGGIMISATPGLGNYLL
KPSANGLPLPGVDADVFTEDGKQAKPREKGYIVIKRPWPGMLAGVWGDPERYVKTYFSKF
PGVYYPGDYAVRDEEGFFYILGRADEVLKIAGHRIGTREIEDILISHPAVAESAVIGVPD
PVRGEVAVAAIVLKQGYQPSEELRKSLIEYVKNNLGPIVIFGGLYFVSKLPKTRSGKIMR
RVVRSVISGQPLGDVSTLEDETSVDELKKVIEEFTKEIQGQQNEKK
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatcttccatttgaggagaggtactatcagcctccttataagcaactttac
aagcaatcgctcgaagagccggaaaaattctggagagaaatggctgaaggtttagaatgg
ttttccccatttgataaagttttagacgaatcaaacgctccgttctataggtggtttgtt
ggaggtaagatcaatataacttacaacgctttagatagacaggtaaaagttaggagaaat
aagattgcaatttattgggagaacgaaaaaggtgaaagtaggcaattaacttacggcgaa
ctttataatgaagtaaataggtttgcaaaaatacttcaagatttaggaataaagaaagga
gatagagttctaatttacttacctttaatgccagaattaccaattgcgatgctagcttgt
gcaaggattggggcagttcatagcgtagttttctcaggattttctactcaggcagttatt
gatagaataaacgacgcaaaggctaagttagttataaccacctcccatacaatgaggaga
ggtaaaagagtagagttaaaaagaataatagacgaggcagtttctcaaactccttcagtt
gagaaagtactagtaataaaaagggatgaagaaatagaattaaatgaggaaagggacgta
ttatatcaagatttaattaagaggactgggtacaagaaagtagaaccagaggaaactcta
tctactgatccattattcattctttatacttctggaactacaggaaaaccgaaaggaatc
ttacatttacacggtggatatggactatggacttatttgactactcaatgggtcttcgac
ttaagagacaccgatgtattctttaatactgcagatataggctggataactggccattct
tacatagtttatggcccattacaaaacggagcctcagtactaatgtacgaaggagtacca
gattatcctaatccagataggtggtgggagttagtagaaaagtatggagttacagtattc
tacacttctcctacagcaattagatctttaatgaagtacggtgaagaatgggtaaagaag
cacgatttaagcactttaaggattttaggaagcgttggagaacctataaatccggaggca
tggagatggtactttaagaacgttggtaattcttctttacctatagtagatacatggtgg
caaactgaaacaggaggaataatgatttctgcaactccaggtttaggtaactatttactt
aagcctagcgctaacggattaccattaccgggagttgatgcagatgtatttactgaagat
ggtaagcaggcaaagcctagagaaaagggatacattgtaattaagagaccttggccaggt
atgctagcaggggtttggggagatccagaaagatacgtaaagacttacttctccaaattc
cctggagtatattaccccggagattatgctgttagagatgaagaaggattcttctatatc
ttaggaagggctgatgaagtattaaagatagcaggacatagaataggaactagagaaata
gaggacatactaatctctcatcctgcagttgcagaatccgcagtaataggggtaccagat
ccagttaggggcgaagttgcagtagcagctattgtattaaagcaaggctatcaaccatca
gaagaattgagaaagtcgttaatagagtatgttaagaataatttagggcctatagtaata
tttggcggattatatttcgtaagtaagttaccgaagactaggtctggaaagataatgagg
agagtagtgagaagcgtaatttctggacaacctctaggagatgtatcgactttagaggac
gaaacttcagtagacgaactgaagaaggtcatagaagaatttactaaggaaatacaaggt
caacaaaacgagaaaaagtga

DBGET integrated database retrieval system