KEGG   Acidianus hospitalis: Ahos_1022Help
Entry
Ahos_1022         CDS       T01493                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aho  Acidianus hospitalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ahos_1022
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ahos_1022
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ahos_1022
Enzymes [BR:aho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ahos_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
927844..929151
Genome map
AA seq 435 aa AA seqDB search
MTSSFLLTMIVRYDLPQDKIPTTWYNILPDLPEPLPPPKDETGKAFEVLKEVLPSKVLEI
EFSQERYIKIPEEVLEKYLQIGRPTPIIRARKLEEYFGNVVKIYMKMESHTYTGSHKINS
ALAHVYYATLDNAKFVSTETGAGQWGAAVALAAALFHIKAHVFMVRTSYFAKPYRRYLMQ
MYGADVHPSPSEFTPYGREVLQKDPNNPGSLGIAITEAVKYALENGGRYVVGSVVNSDIL
FKTIAGQEAKVQMEMIGEDPDYIIGVVGGGSNYAALAFPFLGEELRSGKVRRKYIASGSL
EVPKMTKGVYKYDYPDTGKILPQLKMYTIGSDFIPPPVYAGGLRYHAVAPTLSLLMSKGI
VEARDYDQETAFAWAKLFSQIEGWVPAPETSHALPIIKEIADEAKKSGEKKTVLVSFSGH
GLLDLANYAEVLGFK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttctttcttattaactatgattgttagatatgatcttccgcaggataaaata
cccacaacttggtataatatattgccagatcttccagaacctttaccaccacctaaggat
gaaacaggaaaggcttttgaagtattgaaggaagtattaccttcaaaagtccttgaaata
gaattttcacaagaaagatatataaaaattcctgaagaagtccttgaaaaatatttacaa
ataggaagaccaactccaattataagagctaggaagcttgaagaatatttcggtaacgta
gttaagatttacatgaaaatggaaagtcatacttatactggttcacataagattaatagt
gcgttagctcacgtttattatgcgacattagataatgctaaattcgtttcaactgaaact
ggtgcaggccaatggggagctgcagttgctttagccgctgcattattccatattaaggct
cacgtttttatggtaaggactagttattttgcaaaaccttatagaagatacttaatgcaa
atgtacggtgcagatgtccatccgtctccttcagaatttactccttacggaagagaagtt
ttacagaaggatcctaataatcctggctcccttggaatagcgataacagaagcagttaaa
tatgctctagagaatggaggaagatacgttgtagggagtgtagtgaattctgacatactc
tttaagaccatagcaggacaagaagctaaagttcaaatggaaatgataggagaggatcca
gattacatcataggagtagtaggtggaggatcaaattatgcagctttagcttttcctttc
ttaggagaggagttacgttctggaaaagttagaagaaaatacattgcctctggatcttta
gaagttcccaagatgaccaaaggggtttataaatacgattatccggacacaggaaaaata
ttacctcagcttaagatgtatactataggctcagatttcattcctccaccagtttatgca
ggtgggttaagatatcacgcagtcgcacctactttatctctattgatgagcaaaggaata
gttgaggcgagagattacgaccaggaaacggcatttgcttgggctaagctattttctcaa
atagagggatgggttccagctccggaaacaagtcatgcgttaccaataattaaggagatt
gctgatgaagcaaagaagtctggagaaaagaaaacagtactggttagcttttctggccat
ggtctattagatttagcaaactatgctgaagtactaggtttcaaatga

DBGET integrated database retrieval system