KEGG   Acidianus hospitalis: Ahos_1146Help
Entry
Ahos_1146         CDS       T01493                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
aho  Acidianus hospitalis
Pathway
aho00340  Histidine metabolism
aho01100  Metabolic pathways
aho01110  Biosynthesis of secondary metabolites
aho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Ahos_1146
Enzymes [BR:aho01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Ahos_1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEE94030
UniProt: F4BA33
Position
complement(1037371..1038561)
Genome map
AA seq 396 aa AA seqDB search
MIIKELPKSRPISFDQVLDKVSEIVGKVKREGDKALIEFTEKFDGIKLDNIKVTKEEIHA
AASLLSEDIKKAIDVVSEQIKEFHTSIKPPQIGGGKSGVDFGIIWTPLEKVGIYVPGGKK
LYPSTLLMAGIPAIVAGVEEIYVATPTKGKIDPAIAYIAEKLNVKEIYKIGGAQAIAALA
YGTESVKKVDKIVGPGNVYVQAAKYIVSKDVGIDGIEGPTELVIVADDSANSEEIYLDLL
AQGEHGNSTLLVLISTSDRILREVEEKVSGSDLTFYLVKARDLEEAITYANSIAPEHLSL
QVSSPREALKMVRNAGAVTLGRTPPAIIDYSAGPDHILPTNSWAKFKGGLTVYDFLKPIS
FAQATNPDKELINAAITLARYEGFEIHSKSIGERYV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgataataaaagagcttcctaaaagtaggcctataagttttgatcaagttctggacaag
gtaagcgagattgtagggaaagtaaaaagagaaggggacaaagccttaattgaatttact
gaaaaattcgacggcataaagcttgataatataaaagttacaaaggaagagattcacgct
gcggcttcattactttctgaagacattaagaaggcaatagatgtagtctcagagcaaata
aaggaatttcacacttcaataaagcctcctcaaataggcggtggaaaaagtggagttgac
tttgggataatttggactccgttagaaaaggtaggaatttatgtgccaggcggtaaaaag
ctttatccatcaacactactaatggcaggaatacctgcaatagttgctggagttgaagaa
atttatgttgcaacgcctactaaaggtaaaattgatcctgcaattgcatatattgcagaa
aaacttaatgtaaaggaaatatacaaaattggtggagcacaagctattgctgcattggct
tacggaacggaaagcgttaagaaagtagataagatagtcggacctggaaatgtttacgtt
caagcagcaaaatacattgtaagcaaagatgtaggaatagatggaatagaaggccctaca
gaattagttattgttgctgatgattcagctaattctgaggaaatttaccttgatttactt
gctcagggagaacatggaaattccacgttattagttttaatttctacttctgatagaata
ttaagagaagtagaggaaaaagtttctggttctgaccttactttttatttagttaaagca
agagatcttgaagaagcaataacttatgcaaactctatagctccagaacacctttctttg
caagtttcttctccacgagaagccctaaaaatggtaagaaatgctggtgcagtgacttta
ggtagaactcctcctgcaattattgattatagtgctgggccagatcatattttgccgact
aatagttgggctaaattcaaaggaggactgacagtatacgatttccttaagcctatctct
tttgctcaagctactaacccagataaggagctaatcaatgctgcaattactttagcaaga
tatgaaggattcgaaattcactctaaaagcataggtgagaggtatgtctga

DBGET integrated database retrieval system