KEGG   Acidianus hospitalis: Ahos_1348Help
Entry
Ahos_1348         CDS       T01493                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aho  Acidianus hospitalis
Pathway
aho00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aho01100  Metabolic pathways
aho01110  Biosynthesis of secondary metabolites
aho01130  Biosynthesis of antibiotics
aho01230  Biosynthesis of amino acids
Module
aho_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ahos_1348
Enzymes [BR:aho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ahos_1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEE94231
UniProt: F4B4C3
Position
complement(1216973..1217719)
Genome map
AA seq 248 aa AA seqDB search
MVRFLTGWLKDVVNNAYSRPYVHKIRDKPVFSLIDAIRKVKEENKNPIIAEYKRASPSGF
SADRDPIEYAKEMERSGAVGISVLTEDKFFSGSYDYLFIISHTVKIPVLMKDFVVTERQI
DNAYNLGADSILLIVRILTERELESLILYARSYRLEPLVEIFDENELEMALNAGAKIIGV
NSRDLLTFAIDQERVKRVLRKIPSNVIRVAESGITSKEQIEELKKYGADAFLIGSSLMKE
PSKIKELI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggttagattcctaactggctggttaaaagatgtagttaataatgcatatagtagacct
tatgttcataaaattagagataagccagtcttctcattaatcgatgcgataagaaaagta
aaagaagaaaataagaaccctatcatagcagaatataaaagagcttctccttctggattt
tctgcagatagagatcctatagaatatgcaaaagaaatggaaagatctggtgctgtagga
attagcgtgttaaccgaagataaatttttttctggttcgtatgattatttatttataata
tctcatactgttaaaattccagttttaatgaaagattttgtggtcactgaaaggcaaata
gataacgcatacaatttaggtgctgatagtattttgcttatagttagaattttaactgag
agagagctcgaaagcctgatactttatgcaaggtcgtatagattagagcctttagtagaa
atttttgacgaaaatgaactagaaatggcattaaacgccggtgcaaaaattattggcgtt
aattctagggatttgcttacatttgccattgatcaagaaagggtgaaaagagttttgaga
aaaattccatcaaacgttataagagtagctgaaagcggtataacttctaaggaacaaata
gaagaactaaaaaaatacggtgcagacgcttttctaataggaagttccctaatgaaggaa
ccaagtaaaattaaagaattaatttag

DBGET integrated database retrieval system