KEGG   Acidianus hospitalis: Ahos_1353Help
Entry
Ahos_1353         CDS       T01493                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aho  Acidianus hospitalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ahos_1353
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ahos_1353
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ahos_1353
Enzymes [BR:aho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ahos_1353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1221168..1221902)
Genome map
AA seq 244 aa AA seqDB search
MSKMLVSYATLGYPKEKEYLEFIDGCVKEGSDILEIGVPPKYAKYDGPVIRRSYKQVSSW
LKDIWPLLKETRDRVKIPIIILTYLEDWLPVLDDFLSNLAKIGIDGILFPDLIIDYVDEY
EKYVKKIKDHGLKAVIFTAPSVPDPLIQKVSKISDIFLYYGVRPTTGVPIPVSVDSLITR
IRILVDNKLVVGFGLSDVEDMRKALRAGADGIAIGTAYIEAIEKGGVQDAINLVKYFRGV
LNEF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagatgctagtttcttacgctacactaggttatcctaaagaaaaggaatacttg
gaatttattgatggatgcgtcaaggagggttcggatattttagaaatcggtgttccacca
aagtatgctaaatacgacggtccagttataagaagaagttataagcaagtatctagctgg
ttaaaggacatttggccattattaaaagagactagagatagagtaaaaattcccataata
atcttaacgtatcttgaagattggttaccagtacttgacgatttcctctctaatttagct
aagataggcattgatggtatactatttccagatttaataatagattatgtagacgagtat
gagaaatacgttaagaaaattaaggatcatgggttaaaagccgtaatatttactgctcct
tcagttccagatcccctgatacaaaaagtatctaaaatttctgatattttcttatattat
ggagtaagacctactactggagttcctattccagtaagtgtagactcattaattacaaga
attagaatattagtagataataagctagtagtaggttttggattgtctgatgtagaagac
atgagaaaggcattaagggctggagcggatggcatagctataggtacagcatatatagaa
gctatagagaaaggtggagttcaagacgcaataaatttagtaaaatatttcagaggtgtt
ttaaatgaattttaa

DBGET integrated database retrieval system