KEGG   Acidianus hospitalis: Ahos_1354Help
Entry
Ahos_1354         CDS       T01493                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aho  Acidianus hospitalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ahos_1354
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ahos_1354
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ahos_1354
Enzymes [BR:aho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Ahos_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1221899..1223041)
Genome map
AA seq 380 aa AA seqDB search
MPKEVLRQQFTVERFIKIPEEVREAYLNIGRPTPLMRAKRLEEMLNTPAKIYFKFEGATP
TGSHKINTALPQAYFAKAEGVNHVVTETGAGQWGTAVALAARMYNMESTIFMVKVSYEQK
PQRRTIMELYGGKVYASPTNLTEYGRKVLAENPSHPGSLGVAMSEAIEYALTNNYRYLVG
SVLDVAILHQSVIGQEAMKQMDILGEEPDILIGCVGGGSNFGGFAFPFLGAKRGEKFIAV
GSYEIPKFSQGDYMYDFPDSAGLLPMVKMITLGKDYVPPPIYAGGLRYHGAAPSLSLLIK
EGIVEWREYSEPEIFEAAKLFAEAQGIVPAPESAHAIKAVIDEALKVKKNHERKVIVFNL
SGHGLLDLPNYESMMKRLSK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggaagttttaaggcaacagtttactgtggagagatttataaaaattccagaa
gaggtaagggaagcgtaccttaatataggtagaccaactcccttaatgagggcaaaaaga
cttgaagaaatgctaaacactcctgcaaaaatttacttcaagtttgaaggtgccactccc
acaggttcacataagataaacactgctttacctcaagcgtattttgctaaagcagaagga
gttaatcatgtagttacagagactggagctgggcagtggggtacagccgtagctttagca
gcaaggatgtataacatggaatctacaattttcatggtaaaagtaagttatgaacaaaag
cctcagagaagaactataatggaattatatggaggaaaagtttacgcaagtcctacaaat
ttaacggaatatggaaggaaagttttagctgaaaatccttctcatccaggatctttagga
gtagcaatgagcgaggcaatagaatatgccttaactaataattatagatatctagtaggt
agcgtattagatgtagcaatactccaccagagcgttataggccaagaagcaatgaagcag
atggatattctaggtgaggagccagatatcttaataggatgtgtaggtggaggaagtaat
ttcggtggctttgcgtttcctttcttaggagctaaaagaggagaaaaattcattgcagta
ggttcttacgaaatacctaaatttagtcaaggagattatatgtatgatttcccagacagt
gcgggtttattgccaatggtaaagatgataactttaggtaaggattatgtaccacctcca
atatatgcaggaggtcttagatatcacggtgcggcaccgtccttaagtctactcataaaa
gaagggatagtcgaatggagagaatatagtgaaccagagatattcgaggctgcaaaattg
tttgctgaagctcagggaatagttccagcaccggaatcagcacatgcgataaaagccgtt
atagatgaggcattaaaagttaagaagaatcacgagagaaaagttatcgtatttaattta
agtggtcatgggttattggatttaccaaactatgagtcaatgatgaaaaggttatcaaaa
tga

DBGET integrated database retrieval system