KEGG   Acidianus hospitalis: Ahos_1354Help
Entry
Ahos_1354         CDS       T01493                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aho  Acidianus hospitalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aho01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aho00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aho00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1221899..1223041)
Genome map
AA seq 380 aa AA seqDB search
MPKEVLRQQFTVERFIKIPEEVREAYLNIGRPTPLMRAKRLEEMLNTPAKIYFKFEGATP
TGSHKINTALPQAYFAKAEGVNHVVTETGAGQWGTAVALAARMYNMESTIFMVKVSYEQK
PQRRTIMELYGGKVYASPTNLTEYGRKVLAENPSHPGSLGVAMSEAIEYALTNNYRYLVG
SVLDVAILHQSVIGQEAMKQMDILGEEPDILIGCVGGGSNFGGFAFPFLGAKRGEKFIAV
GSYEIPKFSQGDYMYDFPDSAGLLPMVKMITLGKDYVPPPIYAGGLRYHGAAPSLSLLIK
EGIVEWREYSEPEIFEAAKLFAEAQGIVPAPESAHAIKAVIDEALKVKKNHERKVIVFNL
SGHGLLDLPNYESMMKRLSK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaggaagttttaaggcaacagtttactgtggagagatttataaaaattccagaa
gaggtaagggaagcgtaccttaatataggtagaccaactcccttaatgagggcaaaaaga
cttgaagaaatgctaaacactcctgcaaaaatttacttcaagtttgaaggtgccactccc
acaggttcacataagataaacactgctttacctcaagcgtattttgctaaagcagaagga
gttaatcatgtagttacagagactggagctgggcagtggggtacagccgtagctttagca
gcaaggatgtataacatggaatctacaattttcatggtaaaagtaagttatgaacaaaag
cctcagagaagaactataatggaattatatggaggaaaagtttacgcaagtcctacaaat
ttaacggaatatggaaggaaagttttagctgaaaatccttctcatccaggatctttagga
gtagcaatgagcgaggcaatagaatatgccttaactaataattatagatatctagtaggt
agcgtattagatgtagcaatactccaccagagcgttataggccaagaagcaatgaagcag
atggatattctaggtgaggagccagatatcttaataggatgtgtaggtggaggaagtaat
ttcggtggctttgcgtttcctttcttaggagctaaaagaggagaaaaattcattgcagta
ggttcttacgaaatacctaaatttagtcaaggagattatatgtatgatttcccagacagt
gcgggtttattgccaatggtaaagatgataactttaggtaaggattatgtaccacctcca
atatatgcaggaggtcttagatatcacggtgcggcaccgtccttaagtctactcataaaa
gaagggatagtcgaatggagagaatatagtgaaccagagatattcgaggctgcaaaattg
tttgctgaagctcagggaatagttccagcaccggaatcagcacatgcgataaaagccgtt
atagatgaggcattaaaagttaagaagaatcacgagagaaaagttatcgtatttaattta
agtggtcatgggttattggatttaccaaactatgagtcaatgatgaaaaggttatcaaaa
tga

DBGET integrated database retrieval system