KEGG   Acidianus hospitalis: Ahos_1362Help
Entry
Ahos_1362         CDS       T01493                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aho  Acidianus hospitalis
Pathway
aho00260  Glycine, serine and threonine metabolism
aho00750  Vitamin B6 metabolism
aho01100  Metabolic pathways
aho01110  Biosynthesis of secondary metabolites
aho01120  Microbial metabolism in diverse environments
aho01230  Biosynthesis of amino acids
Module
aho_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ahos_1362
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ahos_1362
Enzymes [BR:aho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ahos_1362
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 HypA Capsid_VP7 TF_Zn_Ribbon zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AEE94245
UniProt: F4B4L5
Position
1229875..1231056
Genome map
AA seq 393 aa AA seqDB search
MKCLDCGYETDINQKIITCPRCGGLLEIKVKLKGFSFSNLKGRGVWRYKDAIPGNYSKIV
SINEGNTPLIPSRIYKQTFYKFEGANPTGSFKDRGMTVAVSSAVNTGYKVVAAASTGNTA
ASAAAYASRAGLRIYLVLPKGKVALGKLAQSILYGATILEVNGSFDIAMASVMRLYKDLG
IVYPLNSFNPWRLEGQKTIAYEIAEEIGEPDNVIVPVGNAGNIYAIWKGFTELQEAGVIS
KIPRMIGIQAEGAAPIAKAIEKGLNEPEFFENPETIATAIRIGKPVNWKKAIKAIRSSKG
TALSVSDQEIIDAQKKLAREEGIGAEPASAAALAGYEKAINEGIVDKDQKNVLILTGHAL
KDPDAMLRLDARRILINPEHIENIVLGEINDNN
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgcctagactgcggatatgaaacagatattaatcaaaaaataataacctgcccc
agatgcggcggccttttagaaattaaagtaaaactaaaaggcttctcattctctaacctt
aaaggaagaggagtttggagatataaagacgcaattcctggaaattactctaagatagta
agtataaatgaaggaaatactccattaataccttcaagaatttataagcaaacgttctat
aaatttgaaggagcaaaccctactggaagctttaaagatagaggaatgaccgttgcagta
agctcagcagtaaatactggatataaggtagttgcagcagcgtctacaggaaacactgca
gcttcagcagcagcttatgcatcaagagcaggattaagaatataccttgttttacctaaa
ggcaaagtagcattaggtaagcttgcccaatctattctatatggtgcaacaatactagag
gtcaatggaagttttgatatagccatggcatctgtaatgagactgtataaggatctagga
attgtttatcctctcaactcatttaatccttggaggctggaggggcaaaaaactattgca
tacgaaattgcggaagaaataggagagccagataacgtaattgttccggtaggaaatgca
ggtaacatatatgctatttggaaagggttcactgaactgcaagaggctggggttatttct
aaaatacctagaatgataggaattcaagcagaaggtgctgcaccaatagctaaagccata
gaaaaaggacttaatgagccagaattctttgaaaatccagaaactattgctaccgctatt
agaataggtaagccagtaaattggaaaaaagcaataaaagccataaggagttcaaaaggt
acagcattatcagtttctgatcaagaaattatagatgcacaaaagaaactcgcaagagaa
gaaggaataggagcagaacctgcgtccgctgcagccttagcaggttatgaaaaggcaatc
aacgaaggtatagtagataaggatcaaaagaatgtgttaatcttaacaggacatgcgtta
aaagatccagacgcaatgctaagactagatgcaagaagaatcctaattaatccagaacat
atagaaaatatagttttaggtgagataaatgataataattaa

DBGET integrated database retrieval system