KEGG   Acidianus hospitalis: Ahos_1466Help
Entry
Ahos_1466         CDS       T01493                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aho  Acidianus hospitalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ahos_1466
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ahos_1466
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ahos_1466
Enzymes [BR:aho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ahos_1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1327817..1328830
Genome map
AA seq 337 aa AA seqDB search
MKQVCMRCGKEREGLELRCKRCGGPFKVEVEDLPFSRSLRDNFPYIKSWISLGEWNTPMI
KNGEIYFKLDFLNPTGSYKDRGSVTLISYLAENGINAISEDSSGNAGASIAAYGSAAGML
VKIFVPSTARGNKLKQIESYGAEVVKVEGSREEVAKAAENSPYYYASHVLQPQFRDGIRS
LAYEIVRDLGWRAPDNIFLPTSAGTLLLGVFEGFRHMFNQGIIAKIPNIIAVQTEQVMPL
CSKVKGIKYTPPEKVTSIADALVSTDPFLLPEMVEVIRKYGDCIVVNDEEILDSWKELAR
KGLLVEYSSATVYSAYKKSKPEGLSVLALTGSGLKVL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtttgcatgcgttgtggcaaagaaagggaaggtctagaattgcgttgtaaa
agatgtggaggtccatttaaagttgaagttgaagatttacctttctctagaagcttaaga
gataatttcccttacataaagtcttggatttctttaggagaatggaatacgcctatgata
aaaaatggagaaatctattttaagctggattttcttaatcctacgggctcttacaaagat
agaggttctgtaactttaatttcgtatttagcagagaatggaataaatgcgatatcagag
gattcttctggtaacgctggagcttctattgccgcctatggttctgctgccggaatgctt
gttaaaatatttgttccatcaaccgctagagggaataagctaaagcaaatagaaagctat
ggtgcagaagtagtgaaagttgaaggaagcagggaagaagtagcaaaggctgctgaaaat
tctccctactattatgcttcacatgttcttcagcctcagtttagagacggtataagatct
ttagcttatgaaattgtaagggatttaggttggagggctccagataatatatttttgcct
acatcagcaggtactttattgcttggagttttcgaaggttttaggcatatgtttaatcaa
ggtataatagccaaaattcctaatataatagcagttcaaactgagcaagtaatgcctctt
tgttctaaagtcaagggaataaaatatactccgccagagaaagtaacgtctattgctgat
gcattagtttctactgatcctttccttttacctgagatggtagaggttataagaaagtat
ggtgactgtatagtagttaatgacgaggaaattttagactcttggaaggaactagcaagg
aaaggtttgcttgtagaatatagttctgcaacagtttactctgcatataagaaaagtaag
ccagaaggtctcagtgttttagcgctaactggtagtggcttgaaagttctatag

DBGET integrated database retrieval system