KEGG   Acidianus hospitalis: Ahos_1466Help
Entry
Ahos_1466         CDS       T01493                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aho  Acidianus hospitalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ahos_1466
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ahos_1466
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ahos_1466
Enzymes [BR:aho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ahos_1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1327817..1328830
Genome map
AA seq 337 aa AA seqDB search
MKQVCMRCGKEREGLELRCKRCGGPFKVEVEDLPFSRSLRDNFPYIKSWISLGEWNTPMI
KNGEIYFKLDFLNPTGSYKDRGSVTLISYLAENGINAISEDSSGNAGASIAAYGSAAGML
VKIFVPSTARGNKLKQIESYGAEVVKVEGSREEVAKAAENSPYYYASHVLQPQFRDGIRS
LAYEIVRDLGWRAPDNIFLPTSAGTLLLGVFEGFRHMFNQGIIAKIPNIIAVQTEQVMPL
CSKVKGIKYTPPEKVTSIADALVSTDPFLLPEMVEVIRKYGDCIVVNDEEILDSWKELAR
KGLLVEYSSATVYSAYKKSKPEGLSVLALTGSGLKVL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagtttgcatgcgttgtggcaaagaaagggaaggtctagaattgcgttgtaaa
agatgtggaggtccatttaaagttgaagttgaagatttacctttctctagaagcttaaga
gataatttcccttacataaagtcttggatttctttaggagaatggaatacgcctatgata
aaaaatggagaaatctattttaagctggattttcttaatcctacgggctcttacaaagat
agaggttctgtaactttaatttcgtatttagcagagaatggaataaatgcgatatcagag
gattcttctggtaacgctggagcttctattgccgcctatggttctgctgccggaatgctt
gttaaaatatttgttccatcaaccgctagagggaataagctaaagcaaatagaaagctat
ggtgcagaagtagtgaaagttgaaggaagcagggaagaagtagcaaaggctgctgaaaat
tctccctactattatgcttcacatgttcttcagcctcagtttagagacggtataagatct
ttagcttatgaaattgtaagggatttaggttggagggctccagataatatatttttgcct
acatcagcaggtactttattgcttggagttttcgaaggttttaggcatatgtttaatcaa
ggtataatagccaaaattcctaatataatagcagttcaaactgagcaagtaatgcctctt
tgttctaaagtcaagggaataaaatatactccgccagagaaagtaacgtctattgctgat
gcattagtttctactgatcctttccttttacctgagatggtagaggttataagaaagtat
ggtgactgtatagtagttaatgacgaggaaattttagactcttggaaggaactagcaagg
aaaggtttgcttgtagaatatagttctgcaacagtttactctgcatataagaaaagtaag
ccagaaggtctcagtgttttagcgctaactggtagtggcttgaaagttctatag

DBGET integrated database retrieval system