KEGG   Acidianus hospitalis: Ahos_1484Help
Entry
Ahos_1484         CDS       T01493                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aho  Acidianus hospitalis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ahos_1484
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ahos_1484
   00640 Propanoate metabolism
    Ahos_1484
   00660 C5-Branched dibasic acid metabolism
    Ahos_1484
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ahos_1484
Enzymes [BR:aho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ahos_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1345025..1346032
Genome map
AA seq 335 aa AA seqDB search
MKLYEYEGKLLFSKVGIKIPHGIVTEGNIDWKGKAVVKAQILEGGRGKRGLVKVTDDVNS
TIQEMRKLGINKFLVEEYIPHDREVYLSMILDRDTAEPMLIASPHGGIDIESSGEVKKFI
IPIERGPRGYDIIEIEKYLGVKGLFQVIQGLYKIFTEYDAELVEINPLAVTDNGVIALDS
KVILEDNALYKHQDFLKEINREYSPDSYVELDGDIGIIGNGAGLTMATMDMVKLMGGNPA
DFMDVGGGADRERVRYCVIKVGSNPKVKKILVNIYGGITRCDEVALGIVDAYNVIKKPIF
VRLVGTNEEEGWKILKEHGINFYENPIDAVRDALR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttatgaatatgaaggaaagcttctattttctaaggtaggaataaaaatacct
cacggaatagtaactgaaggtaatatagattggaaaggaaaagctgttgttaaagctcaa
attctagaaggtggaagaggaaaaagaggacttgttaaggtaactgatgatgttaactct
acaatacaagagatgagaaaactaggcataaataaatttctagttgaggaatatattccc
catgatagagaagtttatctttccatgattcttgatagagatacggcagaacctatgcta
atagcctcacctcacggtggaattgatattgaaagctctggtgaagtaaagaagtttata
attcctatagaaaggggacctagaggatatgatataatagagatagaaaaatatttaggc
gtaaaaggtttatttcaagtaattcaaggcttatacaagatttttacagagtacgacgct
gagctggtagaaattaatccgttggctgtaactgataacggcgtaatagctcttgattcc
aaagtgatcttagaggataatgcactttacaagcatcaggattttctaaaggaaattaac
agggagtattctccagatagttatgtagaacttgatggagatataggaataatcggcaat
ggagcaggtttaactatggccacaatggatatggtaaaactaatgggaggaaaccctgca
gatttcatggacgtaggaggaggagcggatagggaaagagttagatattgtgttataaaa
gttgggtcaaatcctaaggtaaagaaaatccttgtaaatatatatggtggtataactagg
tgtgacgaggtcgcattgggaattgttgatgcgtataatgtgataaagaagccaatattc
gttagattagtcggaactaatgaggaagaaggttggaaaatccttaaggaacatggaatt
aatttttatgaaaatccaatagacgcggtgagggatgcactacgctga

DBGET integrated database retrieval system