KEGG   Acidianus hospitalis: Ahos_1484Help
Entry
Ahos_1484         CDS       T01493                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
aho  Acidianus hospitalis
Pathway
aho00020  Citrate cycle (TCA cycle)
aho00640  Propanoate metabolism
aho00660  C5-Branched dibasic acid metabolism
aho00720  Carbon fixation pathways in prokaryotes
aho01100  Metabolic pathways
aho01110  Biosynthesis of secondary metabolites
aho01120  Microbial metabolism in diverse environments
aho01130  Biosynthesis of antibiotics
aho01200  Carbon metabolism
Module
aho_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aho_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ahos_1484
   00640 Propanoate metabolism
    Ahos_1484
   00660 C5-Branched dibasic acid metabolism
    Ahos_1484
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ahos_1484
Enzymes [BR:aho01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ahos_1484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEE94367
UniProt: F4B565
Position
1345025..1346032
Genome map
AA seq 335 aa AA seqDB search
MKLYEYEGKLLFSKVGIKIPHGIVTEGNIDWKGKAVVKAQILEGGRGKRGLVKVTDDVNS
TIQEMRKLGINKFLVEEYIPHDREVYLSMILDRDTAEPMLIASPHGGIDIESSGEVKKFI
IPIERGPRGYDIIEIEKYLGVKGLFQVIQGLYKIFTEYDAELVEINPLAVTDNGVIALDS
KVILEDNALYKHQDFLKEINREYSPDSYVELDGDIGIIGNGAGLTMATMDMVKLMGGNPA
DFMDVGGGADRERVRYCVIKVGSNPKVKKILVNIYGGITRCDEVALGIVDAYNVIKKPIF
VRLVGTNEEEGWKILKEHGINFYENPIDAVRDALR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttatgaatatgaaggaaagcttctattttctaaggtaggaataaaaatacct
cacggaatagtaactgaaggtaatatagattggaaaggaaaagctgttgttaaagctcaa
attctagaaggtggaagaggaaaaagaggacttgttaaggtaactgatgatgttaactct
acaatacaagagatgagaaaactaggcataaataaatttctagttgaggaatatattccc
catgatagagaagtttatctttccatgattcttgatagagatacggcagaacctatgcta
atagcctcacctcacggtggaattgatattgaaagctctggtgaagtaaagaagtttata
attcctatagaaaggggacctagaggatatgatataatagagatagaaaaatatttaggc
gtaaaaggtttatttcaagtaattcaaggcttatacaagatttttacagagtacgacgct
gagctggtagaaattaatccgttggctgtaactgataacggcgtaatagctcttgattcc
aaagtgatcttagaggataatgcactttacaagcatcaggattttctaaaggaaattaac
agggagtattctccagatagttatgtagaacttgatggagatataggaataatcggcaat
ggagcaggtttaactatggccacaatggatatggtaaaactaatgggaggaaaccctgca
gatttcatggacgtaggaggaggagcggatagggaaagagttagatattgtgttataaaa
gttgggtcaaatcctaaggtaaagaaaatccttgtaaatatatatggtggtataactagg
tgtgacgaggtcgcattgggaattgttgatgcgtataatgtgataaagaagccaatattc
gttagattagtcggaactaatgaggaagaaggttggaaaatccttaaggaacatggaatt
aatttttatgaaaatccaatagacgcggtgagggatgcactacgctga

DBGET integrated database retrieval system