KEGG   Acidianus hospitalis: Ahos_1691Help
Entry
Ahos_1691         CDS       T01493                                 

Definition
(GenBank) CoB--CoM heterodisulfide reductase
  KO
K03389  heterodisulfide reductase subunit B2 [EC:1.8.7.3 1.8.98.4 1.8.98.5 1.8.98.6]
Organism
aho  Acidianus hospitalis
Pathway
aho00680  Methane metabolism
aho01100  Metabolic pathways
aho01120  Microbial metabolism in diverse environments
aho01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Ahos_1691
Enzymes [BR:aho01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.3  ferredoxin:CoB-CoM heterodisulfide reductase
     Ahos_1691
   1.8.98  With other, known, physiological acceptors
    1.8.98.4  coenzyme F420:CoB-CoM heterodisulfide,ferredoxin reductase
     Ahos_1691
    1.8.98.5  H2:CoB-CoM heterodisulfide,ferredoxin reductase
     Ahos_1691
    1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase
     Ahos_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCG
Motif
Other DBs
NCBI-ProteinID: AEE94568
UniProt: F4B6E8
Position
complement(1524809..1525726)
Genome map
AA seq 305 aa AA seqDB search
MSTNNPYGKVAFYPGCALDGLGKSYDVSLRLVAEDLGLKFERLDDYNCCGALEVKNVNTM
AGLLLPARNLSLARKIGANAIMSACPGCHYSLSRTQYYMSKYTKVRDKVNAYLEKMGEKP
YDLQLMTIHAVEYFYNTVGVEGIKAKVKRPLTGLKVAPYYGCLYTRPKPYTLAGYMKLKD
DPERPIFMDELLKALGAEVVPFEAKTMCCGGPHVYSDVEVALHLEARILKEAKRNGADML
VVDCPLGGVALETNMNKIAEKYGEDLRMPIVYFTQLMAFAFGHSPEEALLTANLTNPMSI
LKKYL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaataatccatacggcaaagtagccttctatcctggatgtgcattagacgga
ttaggaaagtcgtacgacgtttcgttaaggctagtagcggaagaccttggacttaaattc
gagagacttgatgactataactgttgcggtgcattagaagttaagaacgtaaatacaatg
gccggattacttctccctgctaggaacttatcgttagctaggaaaataggggctaacgca
ataatgtctgcctgcccaggttgtcattactctctatctagaacgcaatattacatgagt
aaatacactaaagttagggataaagttaacgcgtacttagagaagatgggagagaaacct
tacgacctccagttaatgaccattcacgcagtagagtacttctataatactgtgggtgtt
gaaggaataaaggctaaagtcaagaggccattgactggattaaaggttgctccctactac
ggttgtttatacactagaccaaaaccttatactttagctggatacatgaagttaaaggac
gatccagagagaccaatattcatggacgagctattgaaggctttaggagcagaagtagtg
ccatttgaggctaaaacaatgtgttgcggaggaccgcacgtttattctgacgttgaggta
gctttacaccttgaggcaagaatattaaaggaagctaagaggaacggtgcagatatgtta
gtcgtagactgtccattaggtggcgttgccttagagactaatatgaataagattgcagaa
aagtacggagaagacttgaggatgcctatagtttactttacacagctgatggcatttgcg
tttgggcatagtccagaagaggcattattaacagctaacttaactaacccaatgagcatt
ctaaagaagtatttgtaa

DBGET integrated database retrieval system