KEGG   Acidianus hospitalis: Ahos_1691Help
Entry
Ahos_1691         CDS       T01493                                 

Definition
CoB--CoM heterodisulfide reductase
Orthology
K03389  
heterodisulfide reductase subunit B [EC:1.8.98.1]
Organism
aho  Acidianus hospitalis
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:aho01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:aho00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1524809..1525726)
Genome map
AA seq 305 aa AA seqDB search
MSTNNPYGKVAFYPGCALDGLGKSYDVSLRLVAEDLGLKFERLDDYNCCGALEVKNVNTM
AGLLLPARNLSLARKIGANAIMSACPGCHYSLSRTQYYMSKYTKVRDKVNAYLEKMGEKP
YDLQLMTIHAVEYFYNTVGVEGIKAKVKRPLTGLKVAPYYGCLYTRPKPYTLAGYMKLKD
DPERPIFMDELLKALGAEVVPFEAKTMCCGGPHVYSDVEVALHLEARILKEAKRNGADML
VVDCPLGGVALETNMNKIAEKYGEDLRMPIVYFTQLMAFAFGHSPEEALLTANLTNPMSI
LKKYL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaataatccatacggcaaagtagccttctatcctggatgtgcattagacgga
ttaggaaagtcgtacgacgtttcgttaaggctagtagcggaagaccttggacttaaattc
gagagacttgatgactataactgttgcggtgcattagaagttaagaacgtaaatacaatg
gccggattacttctccctgctaggaacttatcgttagctaggaaaataggggctaacgca
ataatgtctgcctgcccaggttgtcattactctctatctagaacgcaatattacatgagt
aaatacactaaagttagggataaagttaacgcgtacttagagaagatgggagagaaacct
tacgacctccagttaatgaccattcacgcagtagagtacttctataatactgtgggtgtt
gaaggaataaaggctaaagtcaagaggccattgactggattaaaggttgctccctactac
ggttgtttatacactagaccaaaaccttatactttagctggatacatgaagttaaaggac
gatccagagagaccaatattcatggacgagctattgaaggctttaggagcagaagtagtg
ccatttgaggctaaaacaatgtgttgcggaggaccgcacgtttattctgacgttgaggta
gctttacaccttgaggcaagaatattaaaggaagctaagaggaacggtgcagatatgtta
gtcgtagactgtccattaggtggcgttgccttagagactaatatgaataagattgcagaa
aagtacggagaagacttgaggatgcctatagtttactttacacagctgatggcatttgcg
tttgggcatagtccagaagaggcattattaacagctaacttaactaacccaatgagcatt
ctaaagaagtatttgtaa

DBGET integrated database retrieval system