KEGG   Acidianus hospitalis: Ahos_1949Help
Entry
Ahos_1949         CDS       T01493                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
aho  Acidianus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aho00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ahos_1949
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ahos_1949
   00020 Citrate cycle (TCA cycle)
    Ahos_1949
   00620 Pyruvate metabolism
    Ahos_1949
   00640 Propanoate metabolism
    Ahos_1949
   00650 Butanoate metabolism
    Ahos_1949
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Ahos_1949
   00680 Methane metabolism
    Ahos_1949
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Ahos_1949
Enzymes [BR:aho01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Ahos_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1769119..1770027)
Genome map
AA seq 302 aa AA seqDB search
MTEVPSYIKEKKVIRQQYFLRGNAACPGCPIPKELDLLLEVMGKKTVLVVPASCSTVIMG
DIHGSPSTVPVVHSAFASAAAIASGLSRQLKMRGEDAKVVVWAGDGATGDIGFATVSGAA
ERNEDILYVCYDNEAFMNTGIQRSSLTPYGAWTTTTPAGKREFKKPLPFIMMEHKIPYVA
TASIAYPFDYQAKVKKAKDIQGFRYIHLLSPCPPGWRFDSSLTIEVAKLAVETGIWPLFE
VINGEFQLTGISKVLLDKSKRKPITEYLKLQGRFSKMSEKDIKVMQDAVDAMWDYIAELV
KR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtaccctcttatattaaagaaaagaaagtaattagacaacagtacttccta
agaggaaacgctgcctgtccgggctgtcctatacctaaagagttagatttacttctggaa
gttatgggcaagaagacagttctagtagttcctgcatcttgcagtactgtaataatggga
gatattcatggatctccttcaactgttccggtagtacatagtgcttttgcctcggccgca
gcaattgcttcaggattgagcagacaattaaaaatgaggggagaagacgcaaaagtagta
gtttgggcaggagacggagctactggtgatataggatttgctactgttagtggtgcagct
gaaagaaatgaggacatactttacgtatgttacgataacgaagctttcatgaatactgga
attcaaaggtcctctttaactccttacggagcgtggactacaactactcctgcaggtaag
agggaatttaagaaacctctgcctttcattatgatggaacataaaataccttacgtggct
actgcgtctatcgcttatccgttcgattatcaggctaaagttaagaaagcaaaggatatt
caaggatttagatatattcacttattatcgccctgccctccaggttggaggtttgatagc
agtctaactattgaagtagcaaagcttgctgttgagaccggaatttggcctttatttgag
gtaattaacggagagttccagctaacggggataagtaaagttctgctagacaagagtaag
agaaaacctataacagaataccttaaacttcaaggcagattcagcaagatgagcgagaag
gatataaaggtaatgcaggatgctgttgatgccatgtgggattacattgctgaattagtg
aaaaggtaa

DBGET integrated database retrieval system