KEGG   Acidianus hospitalis: Ahos_1949Help
Entry
Ahos_1949         CDS       T01493                                 

Definition
pyruvate ferredoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
aho  Acidianus hospitalis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:aho01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aho00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:aho00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:aho00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aho00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:aho00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:aho00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:aho00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1769119..1770027)
Genome map
AA seq 302 aa AA seqDB search
MTEVPSYIKEKKVIRQQYFLRGNAACPGCPIPKELDLLLEVMGKKTVLVVPASCSTVIMG
DIHGSPSTVPVVHSAFASAAAIASGLSRQLKMRGEDAKVVVWAGDGATGDIGFATVSGAA
ERNEDILYVCYDNEAFMNTGIQRSSLTPYGAWTTTTPAGKREFKKPLPFIMMEHKIPYVA
TASIAYPFDYQAKVKKAKDIQGFRYIHLLSPCPPGWRFDSSLTIEVAKLAVETGIWPLFE
VINGEFQLTGISKVLLDKSKRKPITEYLKLQGRFSKMSEKDIKVMQDAVDAMWDYIAELV
KR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtaccctcttatattaaagaaaagaaagtaattagacaacagtacttccta
agaggaaacgctgcctgtccgggctgtcctatacctaaagagttagatttacttctggaa
gttatgggcaagaagacagttctagtagttcctgcatcttgcagtactgtaataatggga
gatattcatggatctccttcaactgttccggtagtacatagtgcttttgcctcggccgca
gcaattgcttcaggattgagcagacaattaaaaatgaggggagaagacgcaaaagtagta
gtttgggcaggagacggagctactggtgatataggatttgctactgttagtggtgcagct
gaaagaaatgaggacatactttacgtatgttacgataacgaagctttcatgaatactgga
attcaaaggtcctctttaactccttacggagcgtggactacaactactcctgcaggtaag
agggaatttaagaaacctctgcctttcattatgatggaacataaaataccttacgtggct
actgcgtctatcgcttatccgttcgattatcaggctaaagttaagaaagcaaaggatatt
caaggatttagatatattcacttattatcgccctgccctccaggttggaggtttgatagc
agtctaactattgaagtagcaaagcttgctgttgagaccggaatttggcctttatttgag
gtaattaacggagagttccagctaacggggataagtaaagttctgctagacaagagtaag
agaaaacctataacagaataccttaaacttcaaggcagattcagcaagatgagcgagaag
gatataaaggtaatgcaggatgctgttgatgccatgtgggattacattgctgaattagtg
aaaaggtaa

DBGET integrated database retrieval system